COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


XSpike

eXplore the Spike protein sequence in the SARS CoV-2 virus

Last update: Dec 3, 2021
 

Delta Variants
Global
Early 2021 Variants color key
Delta Variants color key

Download

Evaluating 584089 sequences of length 2545
Sampled from 2021-10-04 to 2021-11-28.
Specified Date Range: (datetime.date(2021, 10, 4), datetime.date(2021, 12, 3))
Highest entropy sites for: Global
  Site Entropy
    95  0.6938
   142  0.4263
   222  0.3496
   145  0.2541
  1264  0.1253
   112  0.0956
     5  0.0913
   613  0.0751
  1078  0.0685
   138  0.0685
   850  0.0657
  1104  0.0652
   950  0.0591
    36  0.0586
    70  0.0527
   251  0.0518
    29  0.0485
   181  0.0476
   677  0.0470
  1259  0.0424
   289  0.0392
  1141  0.0391
   250  0.0383
   258  0.0369
    80  0.0359
   484  0.0357
   859  0.0349
    67  0.0344
    18  0.0338
   809  0.0329
   156  0.0325
   675  0.0315
  1162  0.0312
   158  0.0309
  1219  0.0309
   157  0.0304
  1073  0.0301
   812  0.0292
   215  0.0287
   180  0.0282
    26  0.0268
  1020  0.0264
   572  0.0257
  1237  0.0252
   845  0.0250
  1124  0.0249
    19  0.0236
  1101  0.0230
    27  0.0230
   446  0.0229


Most highly correlated site-pairs for: Global
               cramerV  mutInfo
   222    145   0.3876   0.1742
    95    145   0.1144   0.0447
   222   1264   0.1702   0.0314
   158    157   0.7406   0.0302
   156    158   0.7123   0.0299
   156    157   0.6971   0.0297
    29    250   0.5195   0.0275
   145     36   0.1827   0.0261
   222     36   0.1424   0.0214
   145   1264   0.1229   0.0183
   142    950   0.1298   0.0155
    95    142   0.0640   0.0145
    95    112   0.0648   0.0138
   222    289   0.1541   0.0126
   158     19   0.4193   0.0107


    26     27   0.4474   0.0002
   251    250   0.4472   0.0011
   157     19   0.4172   0.0106
   950    157   0.3512   0.0025
   156     19   0.3358   0.0106
   677    675   0.2697   0.0001
   142    138   0.2560   0.0023
  1078    258   0.2395   0.0101
   484    158   0.1855   0.0026
   484    157   0.1844   0.0026
   251    859   0.1742   0.0008
   250    859   0.1741   0.0008
   950     80   0.1642   0.0001
   613     29   0.1634   0.0072
   950    446   0.1624   0.0002


Most common patterns for local area, where Local = Global
                                      111111111111
           111111111222222445666888889000111112222
 1122236789134455588125558487177014555277002461356
58967967005282567801520189642357925090038144129794
LLTPATVAVDTSDGYEFREGDATPWVGETQQQPPAITDAKAHVGLPGMDV  Global     UK  Eu-UK  NAmer   Asia Africa  SAmer  Ocean   Local  Exact  Pct [Context]
                                                    584089 234724 141269 189875   9276    550   5501   2895  584089 <----------- Totals
..R.......I..D.G--...................N............  177069 121251  31993  20252   1011     89    312   2162  177069 127081  71% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...................N............  157001  31025  41743  82143   1070    136    844     40  157001 114846  73% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...................N............   38579    365  10663  24802    839     33   1876      1   38579  28378  73% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..DHG--...V...............N............   23979  22400   1545     19     11      2      1      1   23979  19026  79% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R.......I....G--...................N............   17977   1535   7125   7373   1005      3    476    460   17977  12563  69% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R........L.D.G--...................N............    7483     94     51   7332      3      0      2      1    7483   5696  76% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R..........D.G--...V...............N............    7213   1069   3581   2229    302      0     14     18    7213   4535  62% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I..DHG--...V...............N...........L    6851   6795     52      3      0      0      0      1    6851   4210  61% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+Y145H,V1264L
..R...F...I..DHG--...V...............N............    5492   5431     55      6      0      0      0      0    5492   4722  85% [T19R,V36F,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R.......I..D.G--.................L.N............    4739    273   4356     84     23      0      2      1    4739   3604  76% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R.......I.HD.G--...................N............    4718   4301    101    309      6      0      1      0    4718   3609  76% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
F.R.......I..D.G--...................N............    4324   2027   1922    348     11      0      8      8    4324   3121  72% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N....L.......    3995   1193    942   1836     15      0      8      1    3995   2718  68% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R.......I..D.G--...................N......F.....    3456   3360     73     23      0      0      0      0    3456   2959  85% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,L1141F] Delta
..R.......I..D.G--...................N..S.........    3208   2091   1098     15      2      1      0      1    3208   2577  80% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R..........D.G--.....L.............N............    2950    864   1658    415     12      1      0      0    2950   1880  63% [T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R........L...G--...................N............    2587      1      6   2576      0      0      4      0    2587   1970  76% [T19R,S112L,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R............G--...V...............N............    2501     43    896    539   1009      0     14      0    2501   1876  75% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...V...............N...........L    2454     63    139   2218     30      0      4      0    2454   1216  49% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R..........D.G--...V.......H.......N............    2431      1     21   2399     10      0      0      0    2431   1960  80% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...........H.......N............    2412    776    975    648     11      0      2      0    2412   1825  75% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N] 
F.R..........D.G--...................N............    2383    550    581   1233      6      1     10      2    2383   1709  71% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...................N...........L    2354    313    215    200   1600      0      7     19    2354   1151  48% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R..........D.G--...V...I...........N............    2263     80      4   2177      2      0      0      0    2263   1768  78% [T19R,G142D,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V,V289I
..R............G--................................    2235      0    652   1173     80      2    328      0    2235   1603  71% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
..R.......I..D.G--.............H.....N............    1940   1082    677    148      3      7     23      0    1940    910  46% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R.......I..D.G--..................IN............    1579    753    781     43      2      0      0      0    1579    725  45% [T19R,T95I,I101T,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859I,D950N] Delta
..R.......I..D.G--..............S....N............    1515    223     15   1275      1      0      0      1    1515   1064  70% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N] Delta
..R.......I..D.G--...................N..........Y.    1480    296   1168     14      2      0      0      0    1480   1051  71% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259Y] Delta
..R.......I..D.G--............H......N............    1442    134     43   1265      0      0      0      0    1442    990  68% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R..........D.G--......R............N..S.........    1430      3   1424      1      2      0      0      0    1430   1324  92% [T19R,G142D,E156G,F157-,R158-,W258R,L452R,T478K,D614G,P681R,D950N,A1078S] 
..R.....I....D.G--...................N............    1336      6     14   1315      0      0      1      0    1336    691  51% [T19R,V70I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I....G--...................N....L.......    1309     16    218   1011     12      4     47      1    1309    743  56% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R..A.......D.G--....I......H.......N............    1241     28   1106     98      1      7      1      0    1241    588  47% [T19R,T29A,G142D,E156G,F157-,R158-,T250I,L452R,T478K,Q613H,D614G,P681R,D950N] 
..R......Y...D.G--...................N............    1220     32    184    998      1      4      1      0    1220    847  69% [T19R,D80Y,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--.................L.N............    1166     11   1087     37     31      0      0      0    1166    734  62% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R.......I..D.G--V..................N............    1119   1106      7      6      0      0      0      0    1119    481  42% [T19R,T95I,G142D,E156G,F157-,R158-,E180V,L452R,S459F,T478K,D614G,P681R,D950N] Delta
.FR.......I..D.G--...................N............    1116    892    163     52      4      0      0      5    1116    747  66% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--................................    1098     19    431    446    125      0     77      0    1098    713  64% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
..R..........D.G--.V.................N............    1079    161    672    207     22     10      7      0    1079    840  77% [T19R,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...V...............N...........L    1010      1     55    784    165      0      5      0    1010    518  51% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I..D.G--...................N.......S....     939    625    133    179      2      0      0      0     939    507  53% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] Delta
..R.......I..D.G--...................N.........I..     936    568    302     63      2      1      0      0     936    809  86% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237I] Delta
..R..A.......D.G--....I..............N............     912     76    798     34      2      0      1      1     912    520  57% [T19R,T29A,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N] Delta+T29A,T95_,T250I
..R.......I..D.G--...............S...N............     839    353    473     12      1      0      0      0     839    741  88% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,D950N] Delta
..R............G--...V...I...........N............     816      3      2    804      0      0      7      0     816    631  77% [T19R,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V,V289I
..R..........D.G--...................N..........H.     815      0    814      1      0      0      0      0     815    360  44% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259H] Delta
..R....V.....D.G--...................N............     811    606     29    171      4      1      0      0     811    426  52% [T19R,T22I,A67V,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N...Y........     793    486     53    249      5      0      0      0     793    658  82% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
..R..........D.G--.............H.....N............     782    212    268    294      8      0      0      0     782    541  69% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R..........D.G--...................N..S.........     772    287    286    187      9      3      0      0     772    526  68% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R.......I..D.G--...................N.N..........     756    221     95    435      3      0      2      0     756    570  75% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073N] Delta
..R.....I......G--...................N............     732      0     13    719      0      0      0      0     732    395  53% [T19R,V70I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R......YI..D.G--...................N..S.........     723    721      2      0      0      0      0      0     723    620  85% [T19R,D80Y,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R.......I..D.G--...................N.....V......     722    528    143     39      1      0      2      9     722    510  70% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124V] Delta
..R.......I..D.G--.........Q.........N............     716    107    579     18      7      0      4      1     716    526  73% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,D950N] Delta+E484Q
..R..I....I..D.G--...................N............     684    242    417     24      0      0      0      1     684    557  81% [T19R,T29I,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--..........I........N............     682    399     46    154     83      0      0      0     682    510  74% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,T572I,D614G,P681R,D950N] Delta
..R............G--.....L.............N............     674     24    537    108      2      0      3      0     674    549  81% [T19R,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R.......I..D.G--...................N...........L     672    352    195    116      7      0      1      1     672    426  63% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R..........D.G--..........I........N............     660     34    211    395      9      3      8      0     660    455  68% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,T572I,D614G,P681R,D950N] Delta
..R.......I..D.G--...................NS...........     650    562     72     15      0      0      0      1     650    383  58% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S] Delta
..R.......I..D.G--...........H.......N............     650    378    246     16      4      3      3      0     650    410  63% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N] 
..R.......I..D.G--.V.................N............     640    525     69     46      0      0      0      0     640    430  67% [T19R,T95I,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I.HD.G--................S..N............     635    626      9      0      0      0      0      0     635    541  85% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N] Delta
F.R............G--...................N............     623      3    192    387     11      0     30      0     623    433  69% [L5F,T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...................N........V...     607    439     75     91      2      0      0      0     607    484  79% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219V] Delta
..RS......I..D.G--...................N............     595    375    138     77      4      0      0      1     595    351  58% [T19R,P26S,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..................................N............     593      0     52    442     40     29     30      0     593    422  71% [T19R,L452R,T478K,D614G,P681R,D950N] 
..R.....F.I..D.G--...................N............     586    514     59     13      0      0      0      0     586    480  81% [T19R,V70F,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R....S.....D.G--...................N............     561    379    160     21      1      0      0      0     561    431  76% [T19R,A67S,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.S........D.G--...................N............     556    102    250    203      0      0      1      0     556    408  73% [T19R,A27S,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--..............S....N............     536      2      4    526      4      0      0      0     536    368  68% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N] Delta
..R..........D.G--...................N.....V......     515    117    237    161      0      0      0      0     515    302  58% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124V] Delta
.....................................N............     509      0      2    506      1      0      0      0     509    417  81% [L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...................N........C...     501    300     35    164      0      1      1      0     501    386  77% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219C] Delta
..R.......I..D.G--........V..........N............     491    366     52     59     10      1      0      3     491    382  77% [T19R,T95I,G142D,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--.V.................N............     481      4    392     77      4      1      3      0     481    313  65% [T19R,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--.............H.....N............     471      9    223     58      3      0    178      0     471    191  40% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N,L1265F] Delta+FurinRelated
..R.......I....G--...................N.N..........     461      2     42    195      0      0    221      1     461    371  80% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073N] Delta
..R..........D.G--...................N...Y........     452     48     20    381      2      0      1      0     452    417  92% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
..R..........D.G--...............L...N............     440    212    134     87      4      1      2      0     440    300  68% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812L,D950N] Delta
..R.......I..D.G--..Y................N............     427    366     21     34      5      0      1      0     427    329  77% [T19R,T95I,G142D,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N........C...     410    331     73      6      0      0      0      0     410    284  69% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219C] Delta
..R.......I..D.G--......L............N............     406    215     25    156      2      3      0      5     406    177  43% [T19R,T95I,G142D,E156G,F157-,R158-,W258L,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...................NS...........     397    192     74    129      0      1      1      0     397    349  87% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S] Delta
..R..........D.G--........V..........N............     393     50    135    200      5      1      2      0     393    288  73% [T19R,G142D,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...........H.......N............     393      4    153    213     13      0     10      0     393    234  59% [T19R,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N] 
.FR.......I..DHG--...V...............N...........L     372    372      0      0      0      0      0      0     372    326  87% [L18F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+Y145H,V1264L
..R.......I..D.G--................S..N............     372    334     14     24      0      0      0      0     372    137  36% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,P479S,D614G,P681R,A845S,D950N] Delta
..R.......I...HG--...V...............N............     370    109    254      2      5      0      0      0     370    232  62% [T19R,T95I,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
.FR..........D.G--...................N............     357     24    126    203      1      2      1      0     357    248  69% [L18F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--......L............N............     352     22    137    183      4      0      6      0     352    321  91% [T19R,G142D,E156G,F157-,R158-,W258L,L452R,T478K,D614G,P681R,D950N] 
F.R.......I....G--...................N............     350     19    206    105     15      0      3      2     350    226  64% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N.T..........     336    333      3      0      0      0      0      0     336    288  85% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073T] Delta
..R..........D.G--...................N....L.......     332    182     31    113      3      0      3      0     332    300  90% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R..........D.G--...................N.........I..     326    142     81    102      1      0      0      0     326    214  65% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237I] Delta
..R..........D.G--................S..N............     324    149     53    118      4      0      0      0     324    258  79% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N] Delta
..R......YI..D.G--...................NS...........     317     11    306      0      0      0      0      0     317    271  85% [T19R,D80Y,T95I,G142D,E156G,F157-,R158-,T323I,L452R,T478K,D614G,P681R,D950N,A1020S,T1027I] Delta
..R............G--...V............................     317      0     43     65    207      0      2      0     317    245  77% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R] 
..R.......I..D.G--...................N.......L....     314    181     98     34      1      0      0      0     314    231  73% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162L] Delta
..R.......I..D.G--.E.................N............     308    215     92      0      1      0      0      0     308    278  90% [T19R,T95I,G142D,E156G,F157-,R158-,G181E,L452R,T478K,D614G,P681R,D950N] Delta
..R......Y.....G--...................N............     306      2     56    247      1      0      0      0     306    157  51% [T19R,D80Y,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--..........I........N............     294      5    164    112      4      7      2      0     294    216  73% [T19R,E156G,F157-,R158-,L452R,T478K,T572I,D614G,P681R,D950N] Delta
..RL.........D.G--...................N............     292     55     38    197      0      1      1      0     292    232  79% [T19R,P26L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N........V...     284    220     51      3      4      1      0      5     284    186  65% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219V] Delta
..R.S.....I..D.G--...................N............     282    143     59     72      7      0      1      0     282    168  59% [T19R,A27S,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--..................IN............     278     60     22    191      0      0      5      0     278    216  77% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859I,D950N] Delta
..R.V.....I..D.G--...................N............     273    208     59      4      1      1      0      0     273    228  83% [T19R,A27V,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...V...............N............     264    142     74     28     12      1      6      1     264    148  56% [T19R,T95I,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] 
F.R.......I..DHG--...V...............N............     263    248     15      0      0      0      0      0     263    208  79% [L5F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R.......I..D.G--..................NN............     260      5    232      7      0     16      0      0     260    237  91% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859N,D950N] Delta
..R..I.......D.G--...................N............     259     17     18    224      0      0      0      0     259    214  82% [T19R,T29I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--...S...............N............     257     85    136     33      1      0      1      1     257    212  82% [T19R,T95I,G142D,E156G,F157-,R158-,A222S,L452R,T478K,D614G,P681R,D950N] 
..R.....I.I..DHG--...V...............N............     256     27    229      0      0      0      0      0     256    216  84% [T19R,V70I,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] 
..R.......I....G--............H......N............     254      0      5    246      3      0      0      0     254    187  73% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R....V..I..D.G--...................N............     251    219     18     12      2      0      0      0     251    217  86% [T19R,A67V,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--.............H.....N............     245      1    114    116      4      0     10      0     245    189  77% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R......YI..D.G--...................N............     239    122    102     15      0      0      0      0     239    161  67% [T19R,D80Y,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.....F....D.G--...................N............     239     10     18    208      1      0      2      0     239    208  87% [T19R,V70F,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...................N..........Y.     232     33     73    126      0      0      0      0     232    101  43% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A684V,D950N,D1259Y] Delta
..R.......I..D.G--..H..............L.N............     232      1    231      0      0      0      0      0     232    227  97% [T19R,T95I,G142D,E156G,F157-,R158-,D215H,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R..........D.G--.........Q.........N............     227      8     29    186      3      0      1      0     227    119  52% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,D950N] Delta+E484Q
..R.......I..D.G--Q..................N............     227     13    195      1     18      0      0      0     227    184  81% [T19R,T95I,G142D,E156G,F157-,R158-,E180Q,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--........................L.......     226      1     11    203      1      0     10      0     226    113  50% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,V1104L] 
..R.......I..D.G--...................N..........H.     221      0    214      7      0      0      0      0     221    146  66% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259H] Delta
..R..........D.G--..HV...............N............     221    151     68      1      1      0      0      0     221    170  76% [T19R,G142D,E156G,F157-,R158-,D215H,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...................N.......L....     219     55     31    127      6      0      0      0     219    168  76% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162L] Delta
..R..........D.G--................................     214     11     71     78     20      1     33      0     214    140  65% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
..R.......I..D.G--.........Q.........N....L.......     214    145     51     14      1      2      1      0     214    184  85% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,D950N,V1104L] Delta+E484Q
..R..........D.G--............H......N............     211    154      9     48      0      0      0      0     211    145  68% [V6F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R..........D.G--..Y................N............     211     61     31    112      6      0      1      0     211    121  57% [T19R,G142D,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..........................N............     210      0    115     36     25     33      1      0     210    140  66% [T19R,T95I,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...................N.......S....     199     44     77     76      2      0      0      0     199    103  51% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] Delta
..R..........D.G--...................N.N..........     195     25     27    138      1      1      3      0     195    116  59% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073N] Delta
..R............G--...................N...........L     194      6     63     91     31      0      2      1     194    133  68% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R....S..I..D.G--...................N............     192    159     12     21      0      0      0      0     192    160  83% [T19R,A67S,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--.............H....IN............     191     89     53     49      0      0      0      0     191    160  83% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,T859I,D950N] Delta+FurinRelated
..R.......I..D.G--....I..............N............     187    165     16      6      0      0      0      0     187    119  63% [T19R,T95I,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--...............L...N............     184    149     19     13      3      0      0      0     184    109  59% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812L,D950N] Delta
..R............G--...................N..S.........     182      0     98     82      1      0      1      0     182    147  80% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R..A.........G--....I..............N............     179      5    139     13     22      0      0      0     179    127  70% [T19R,T29A,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N] Delta+T29A,T95_,T250I
..R.......I..D.G--VV.................N............     177    177      0      0      0      0      0      0     177    145  81% [T19R,T95I,G142D,E156G,F157-,R158-,E180V,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.....H.............N............     174      1    162     11      0      0      0      0     174    155  89% [T19R,G142D,E156G,F157-,R158-,P251H,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...V...............N..S.........     172      0      7      0    165      0      0      0     172    133  77% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,A701S,D950N,A1078S] Delta+T95_,A222V
..R.......I..D.G--...................N.M..........     167    166      1      0      0      0      0      0     167    159  95% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073M,V1133I] Delta
..R..........D.G--...S...............N............     165     45     22     97      0      0      1      0     165     95  57% [T19R,G142D,E156G,F157-,R158-,A222S,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--.........K.........N............     165    114     44      5      0      0      2      0     165    137  83% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484K,D614G,P681R,D950N] 
..R.......I..D-G--...................N............     158    155      1      2      0      0      0      0     158    139  87% [T19R,T95I,G142D,V143D,Y144-,Y145-,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.........YD.G--...................N............     155     24     69     59      1      0      2      0     155    134  86% [T19R,D138Y,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R....V.....D.G--...V...............N............     154      5     53      4      0      0     92      0     154    107  69% [T19R,A67V,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..RL......I..D.G--...................N............     154    120     17     17      0      0      0      0     154    120  77% [T19R,P26L,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...............S...N............     150     19     15    113      3      0      0      0     150    122  81% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,D950N] Delta
..R..........D.G--...V........K......N............     150      0    150      0      0      0      0      0     150    143  95% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q675K,P681R,D950N] Delta+FurinRelated
.F.S........Y..............K......................     148      3      3      7      1      0    134      0     148     46  31% [L18F,T20N,P26S,D138Y,R190S,K417T,E484K,N501Y,D614G,H655Y,T1027I,V1176F] Gamma
.............D.G--...................N............     148      0     62     68     13      5      0      0     148    100  67% [G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.S..........G--...................N............     146      0     75     68      1      0      2      0     146     60  41% [T19R,A27S,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.R.................N............     140      1     12    126      0      0      1      0     140     97  69% [T19R,G142D,E156G,F157-,R158-,G181R,L452R,T478K,D614G,P681R,D950N] Delta
F.R..........D.G--..................IN............     140      0    138      2      0      0      0      0     140    138  98% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859I,D950N] Delta
F.R.......I..D.G--...............S...N............     138     41     97      0      0      0      0      0     138    129  93% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,D950N] Delta
..R.......I.AD.G--...................N............     135    133      0      2      0      0      0      0     135     83  61% [T19R,T95I,D138A,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R...F...I..D.G--...................N............     133    113      4     16      0      0      0      0     133    108  81% [T19R,V36F,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--.........A.........N............     131      1     17    113      0      0      0      0     131    109  83% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484A,D614G,P681R,D950N] 
..R.......I.YD.G--...................N............     127     89     16     17      3      0      2      0     127    113  88% [T19R,T95I,D138Y,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--K..................N............     126    126      0      0      0      0      0      0     126    100  79% [T19R,T95I,G142D,E156G,F157-,R158-,L179S,E180K,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--...V...............N............     123      1     39     15     38      0     30      0     123     45  36% [T19R,T95I,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] 
..R.......I....G--...................N..........Y.     122      4    103     14      1      0      0      0     122     91  74% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259Y] Delta
..R....V.......G--...V...............N.........I..     122      0    122      0      0      0      0      0     122    113  92% [T19R,A67V,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,Q1208H,M1237I] Delta+T95_,A222V
..R.......I....G--...................N..S.........     121     70     39      8      1      0      3      0     121     93  76% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R..........D.G--......R............N............     118     14     96      5      2      0      0      1     118     45  38% [T19R,G142D,E156G,F157-,R158-,W258R,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...VI..............N............     118      5    113      0      0      0      0      0     118    107  90% [T19R,G142D,E156G,F157-,R158-,A222V,T250I,S255F,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..RS.........D.G--...................N............     118      7     28     83      0      0      0      0     118     80  67% [T19R,P26S,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..DHG--...................N............     116     88     23      5      0      0      0      0     116     82  70% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R........L...G--................................     113      0      0    111      0      0      2      0     113     89  78% [T19R,S112L,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
.FR............G--...................N............     113      0     18     91      2      0      2      0     113     81  71% [L18F,T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..RL...........G--...................N............     112      0     22     86      0      0      4      0     112     51  45% [T19R,P26L,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R....S.....D.G--...V...............N............     109      0    109      0      0      0      0      0     109    105  96% [V11I,T19R,A67S,G142D,E156G,F157-,R158-,A222V,S255F,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I....G--...................N...Y........     109      1     21     85      1      0      0      1     109     77  70% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
..R.......I..D.......................N............     109      0    101      6      2      0      0      0     109     84  77% [T19R,T95I,G142D,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--................V..N............     108      1     24     83      0      0      0      0     108     93  86% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845V,D950N] Delta
..R.......I..D.G--.............H.....N...........A     108      0    108      0      0      0      0      0     108    102  94% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N,V1264A,L1265F] Delta+FurinRelated
..R............G--...................N.....V......     106      0     47     56      2      0      1      0     106     70  66% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124V] Delta
..R.......I..D.G--.......L...........N............     106     92     12      2      0      0      0      0     106     80  75% [T19R,T95I,G142D,E156G,F157-,R158-,V289L,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...................NS...........     104      0     43     59      0      0      2      0     104     68  65% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S] Delta
..R........L.D.G--...................N...........L     101      0      0    100      1      0      0      0     101     92  91% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R..........D.G--..............S....N............      98      4     27     67      0      0      0      0      98     90  91% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N] Delta
..R...F...I..DHG--...V..........L....N............      98     98      0      0      0      0      0      0      98     74  75% [T19R,V36F,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,P809L,D950N] Delta+Y145H,A222V
..R..A.........G--....I...V..........N............      98      0      1      0     97      0      0      0      98     92  93% [T19R,T29A,E156G,F157-,R158-,T250I,G446V,L452R,T478K,D614G,P681R,D950N] Delta+T29A,T95_,T250I
..R.......I..DHG--.A.V...............N............      98     98      0      0      0      0      0      0      98     96  97% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,G181A,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R..........D.G--......L...I........N............      97      0      0     97      0      0      0      0      97     79  81% [T19R,G142D,E156G,F157-,R158-,W258L,L452R,T478K,T572I,D614G,P681R,D950N] 
..R............G--...................N...Y........      95      1     36     53      0      0      5      0      95     48  50% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
..R............G--...................N....L.......      95      0     53     41      1      0      0      0      95     81  85% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R.......I....G--...................N...........L      94      5     25     59      4      0      0      1      94     78  82% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I..D.G--...............R...N............      94      3     91      0      0      0      0      0      94     92  97% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812R,D950N] Delta
..R............G--...................N........C...      93      0      6     85      0      0      2      0      93     65  69% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219C] Delta
..R..........D.G--..H................N............      93      4     47     40      2      0      0      0      93     60  64% [T19R,G142D,E156G,F157-,R158-,D215H,L452R,T478K,D614G,P681R,D950N] Delta
..R.....F......G--...................N............      93      2     48     41      0      0      2      0      93     81  87% [T19R,V70F,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R............G--...V...............N.....V......      93      0     92      1      0      0      0      0      93     74  79% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1124V] Delta+T95_,A222V
..R.......I....G--Q..................N............      92      0     88      0      4      0      0      0      92     56  60% [T19R,T95I,E156G,F157-,R158-,E180Q,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.......................N............      91      1     72     17      0      1      0      0      91     74  81% [T19R,G142D,L452R,T478K,D614G,P681R,D950N] 
..R..A....I.HD.G--...................N............      91     88      3      0      0      0      0      0      91     85  93% [T19R,T29A,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--................................      90      9     40     21      9      1     10      0      90     57  63% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
..R.......I..D.G--.....L.............N............      89     62     25      2      0      0      0      0      89     77  86% [T19R,T95I,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] 
..R.......IA.D.G--...................N............      89     88      1      0      0      0      0      0      89     72  80% [T19R,T95I,S112A,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--K..................N............      89      1      0     88      0      0      0      0      89     61  68% [T19R,G142D,E156G,F157-,R158-,E180K,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--..........I........N............      88      2     39     47      0      0      0      0      88     78  88% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,T572I,D614G,P681R,D950N] Delta
..R.......I....G--...................NS...........      87      4     76      7      0      0      0      0      87     60  68% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S] Delta
..R..A.........G--....I......H.......N............      87      1     69     16      1      0      0      0      87     49  56% [T19R,T29A,E156G,F157-,R158-,T250I,T299I,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T29A,T95_,T250I,T299I,Q613H
..R.......I..D.G--................V..N............      87     71      9      4      2      1      0      0      87     52  59% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845V,D950N] Delta
F.R........L.D.G--...................N............      86      1      0     85      0      0      0      0      86     69  80% [L5F,T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R............G--...................N.N..........      85      0     35     37      0      1     12      0      85     32  37% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073N] Delta
..R............G--........V..........N............      84      2     22     45      6      0      9      0      84     59  70% [T19R,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N] Delta
..R....V.......G--...................N............      82      2     31     49      0      0      0      0      82     57  69% [T19R,A67V,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
........-.........................................      81      4     50      7     20      0      0      0      81     54  66% [H69-,V70-,Y144-,N501Y,A570D,D614G,P681H,T716I,S982A,D1118H] Alpha
..R.......I....G--...................N.......S....      80      1     53     26      0      0      0      0      80     46  57% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] Delta
..R.......I....G--.................L..............      80      2     73      4      1      0      0      0      80     56  70% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L] 
..R..I....I....G--...................N............      79      0     65     13      1      0      0      0      79     62  78% [T19R,T29I,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
F.R..........D.G--..Y................N............      79      0     79      0      0      0      0      0      79     75  94% [L5F,T19R,G142D,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N,G1167V] Delta
..R.......I..DHG--...V......I........N............      76     73      3      0      0      0      0      0      76     55  72% [T19R,H69R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,T572I,D614G,P681R,D950N] Delta+Y145H,A222V
..R.....F.I..DHG--...V...............N............      76     76      0      0      0      0      0      0      76     74  97% [T19R,V70F,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--.....S.............N............      76      3      0     73      0      0      0      0      76     58  76% [T19R,T95I,G142D,E156G,F157-,R158-,P251S,L452R,T478K,D614G,P681R,D950N] 
..R.......I..DHG--...V...............N..S.........      76     64     11      0      1      0      0      0      76     58  76% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,A1078S] Delta+Y145H,A222V
.FR.......I..D.G--...........H.......N..........Y.      74      0     74      0      0      0      0      0      74     68  91% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N,D1259Y] 
F.R.......I..D.G--............H......N............      73      0      0     73      0      0      0      0      73     66  90% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R..........D.G--...V...............N.....V......      73      4     68      1      0      0      0      0      73     56  76% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1124V] Delta+T95_,A222V
..R..........D.G--.....L............IN............      73     53     20      0      0      0      0      0      73     47  64% [T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,T859I,D950N,D1127G] Delta+T95_,P251L
..R.......I..DHG--...VI..............N............      72     72      0      0      0      0      0      0      72     67  93% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,T250I,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R..........D.G--........S..........N............      72      1     16     54      0      0      1      0      72     52  72% [T19R,G142D,E156G,F157-,R158-,G446S,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N.........T..      72     72      0      0      0      0      0      0      72     68  94% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237T] Delta
...............G--...................N............      71      0      1     69      0      0      1      0      71     53  74% [E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--................S..N...........L      71      0      0      0     71      0      0      0      71     59  83% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N,V1264L] Delta+V1264L
..R.......I....G--.........Q.........N............      70      7     45      9      9      0      0      0      70     54  77% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,D950N] Delta+E484Q
..R..........D.G--.V.........H.......N............      70      1     68      1      0      0      0      0      70     67  95% [T19R,G142D,E156G,F157-,R158-,G181V,L452R,T478K,Q613H,D614G,P681R,D950N] 
..R.....-.I..D.G--...................N............      68     46     21      1      0      0      0      0      68     28  41% [T19R,H69-,V70-,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--..H................N............      68     45      3     15      4      0      1      0      68     46  67% [T19R,T95I,G142D,E156G,F157-,R158-,D215H,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.....H.............N...Y........      68      1     66      0      0      0      1      0      68     66  97% [T19R,G142D,E156G,F157-,R158-,P251H,L452R,T478K,D614G,P681R,D950N,H1101Y] 
FFR.......I..D.G--...................N............      67      3      1     63      0      0      0      0      67     57  85% [L5F,L18F,T19R,T95I,G142D,E156G,F157-,R158-,T323I,L452R,T478K,D614G,P681R,D950N] Delta
..R.S.....I....G--...................N............      65      0     22     42      0      0      1      0      65     50  76% [T19R,A27S,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..RS.........D.G--...V...............N............      65      0     63      0      2      0      0      0      65     57  87% [T19R,P26S,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I..D.G--.........Q.......L.N............      65      0     65      0      0      0      0      0      65     63  96% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,I850L,D950N] Delta+E484Q
..R............G--.........Q.........N............      63      0      9     45      1      0      7      1      63     43  68% [T19R,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,D950N] Delta+E484Q
..R.......I....G--...S...............N............      63      0     50      9      1      0      3      0      63     59  93% [T19R,T95I,E156G,F157-,R158-,A222S,L452R,T478K,D614G,P681R,D950N] 
..R..I....I..DHG--...V...............N...........L      61     61      0      0      0      0      0      0      61     58  95% [S13T,T19R,T29I,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+Y145H,V1264L
..RS......I..D.G--...................N..S.........      61      1     60      0      0      0      0      0      61     59  96% [T19R,P26S,L54F,T95I,G142D,E156G,F157-,R158-,A262S,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R............G--...............S...N............      60      0     11     46      1      0      2      0      60     40  66% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,D950N] Delta
..R.......I....G--........V..........N............      60      3     22     18     12      0      5      0      60     43  71% [T19R,T95I,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--.V.................N............      59      3     45      4      5      2      0      0      59     44  74% [T19R,T95I,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R....V.....D.G--...V...............N.........I..      59      3     56      0      0      0      0      0      59     28  47% [T19R,A67V,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,M1237I] Delta+T95_,A222V
..R.......I....G--...................N.......A....      59      0      0      0      0      0      0     59      59     57  96% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162A] Delta
..R............G--...S...............N............      58      0     10     46      0      0      2      0      58     25  43% [T19R,E156G,F157-,R158-,A222S,L452R,T478K,D614G,P681R,D950N] 
..R.......I..DHG--...V...............N.........I..      58     51      7      0      0      0      0      0      58     44  75% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,M1237I] Delta+Y145H,A222V
F.R.......I..DHG--...V...............N.....V......      58      0     58      0      0      0      0      0      58     56  96% [L5F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1124V] Delta+Y145H,A222V
..R.......I..D.G--................S..N......F.....      58     56      2      0      0      0      0      0      58     57  98% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N,L1141F] Delta
..R.....-......G--...................N............      57      0     41     12      3      0      1      0      57     35  61% [T19R,H69-,V70-,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--.....L.............N..........H.      57      0     56      1      0      0      0      0      57     35  61% [T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N,D1259H] Delta+T95_,P251L
.FR..........D.G--.....L.............N............      57     13     44      0      0      0      0      0      57     50  87% [L18F,T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R.......I.HD.G--...................NS...........      57     57      0      0      0      0      0      0      57     56  98% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S] Delta
..R..........D.G--..G................N............      56      2      2     52      0      0      0      0      56     41  73% [T19R,G142D,E156G,F157-,R158-,D215G,L452R,T478K,D614G,P681R,D950N] Delta
.FR.......I....G--...................N............      56      4     37     12      3      0      0      0      56     37  66% [L18F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--............K......N............      54     54      0      0      0      0      0      0      54     51  94% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675K,P681R,D950N] Delta+FurinRelated
..R............G--..................IN............      53      0      8     44      0      0      1      0      53     33  62% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859I,D950N] Delta
..R............G--...................N.......L....      53      0     11     38      1      0      3      0      53     40  75% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162L] Delta
..R.......I..D.G--...................NV...........      53     47      1      4      0      0      0      1      53     38  71% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020V] Delta
..R..........D.G--..YV...............N............      53      0      1     52      0      0      0      0      53     37  69% [T19R,G142D,E156G,F157-,R158-,D215Y,A222V,R237S,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R............G--.R.................N............      53      0      1     52      0      0      0      0      53     34  64% [T19R,E156G,F157-,R158-,G181R,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--................S..N............      52      0     19     31      1      0      1      0      52     40  76% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N] Delta
..R.......I..DHG--...V.........H.....N............      52     52      0      0      0      0      0      0      52     51  98% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..........I...N............K.........N............      52      0      1     13      0      0     38      0      52     24  46% [T95I,+143T,Y144S,Y145N,R346K,E484K,N501Y,D614G,P681H,D950N] Mu
..R.......I..D..--...................N............      52      0      0     52      0      0      0      0      52     48  92% [T19R,T95I,G142D,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..I..........D.G--...................N............      52      4     14     34      0      0      0      0      52     27  51% [T19I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R..I.........G--...................N............      52      0      8     41      1      0      2      0      52     28  53% [T19R,T29I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.....-....D.G--...................N............      51     15      3     32      1      0      0      0      51     40  78% [T19R,H69-,V70-,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.........HD.G--...................N............      51      4      0     47      0      0      0      0      51     37  72% [T19R,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...V...........................L      51      0      1     46      3      0      1      0      51     24  47% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,V1264L] 
..R..........D.G--............R......N............      51      0     47      2      2      0      0      0      51     48  94% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675R,P681R,D950N] Delta+FurinRelated
.FR.......I..D.G--...................N.......S....      51     51      0      0      0      0      0      0      51     50  98% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] Delta
..R.S........D.G--...................N...Y........      51      0      0     51      0      0      0      0      51     48  94% [T19R,A27S,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
F.R.......I..D.G--...................N.......S....      50     43      6      1      0      0      0      0      50     49  98% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] Delta
..R.V........D.G--...................N............      49      1     17     30      1      0      0      0      49     34  69% [T19R,A27V,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..RS...........G--...................N............      49      1     13     30      0      0      5      0      49     37  75% [T19R,P26S,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--...................N.........I..      49      7      9     32      1      0      0      0      49     37  75% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237I] Delta
..R.......I....G--...................N.....V......      49      3     23     20      3      0      0      0      49     36  73% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124V] Delta
..R..........D.G--...................N.E..........      49     45      3      1      0      0      0      0      49     48  97% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073E] Delta
..R..........D.G--...................NV...........      48      1     22     24      1      0      0      0      48     43  89% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020V] Delta
..RS......I..D.G--...V...............N............      48      6     42      0      0      0      0      0      48     45  93% [T19R,P26S,T95I,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.....................L.N............      47      0     47      0      0      0      0      0      47     36  76% [T19R,T95I,G142D,L452R,T478K,D614G,P681R,I850L,D950N] 
..R.......I....G--..E................N............      47      0      6     41      0      0      0      0      47     38  80% [T19R,T95I,E156G,F157-,R158-,D215E,L452R,T478K,D614G,P681R,D950N] Delta
..R......YI....G--...................NS...........      47      0     47      0      0      0      0      0      47     30  63% [T19R,D80Y,T95I,E156G,F157-,R158-,T323I,L452R,T478K,D614G,P681R,D950N,A1020S,T1027I] Delta
.......V-.I..D-...........SA......................      46      0      2      2      2     37      0      3      46     37  80% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
..R.....L.I..D.G--...................N............      46     27     18      0      1      0      0      0      46     36  78% [T19R,V70L,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I....G--.............H..................      46      0      9      2      1      0     34      0      46     25  54% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R] 
F.R.......I.HD.G--...................N............      46     44      0      2      0      0      0      0      46     27  58% [L5F,T19R,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
F.R..........D.G--...V...............N............      46      8     14     23      1      0      0      0      46     30  65% [L5F,T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I....G--......L............N............      46      3      1     36      6      0      0      0      46     20  43% [T19R,T95I,E156G,F157-,R158-,W258L,K417N,L452R,T478K,D614G,P681R,D950N] 
F.R..I....I..D.G--...................N............      46     42      4      0      0      0      0      0      46     41  89% [L5F,T19R,T29I,T95I,G142D,E156G,F157-,R158-,L452R,T478K,A520S,D614G,P681R,D950N] 
..R..........D.G--...........H.H.....N............      46      0      0     46      0      0      0      0      46     45  97% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R....SF.I..D.G--...................N............      46     45      1      0      0      0      0      0      46     46 100% [T19R,A67S,V70F,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R............G--..............S....N............      45      0     19     26      0      0      0      0      45     35  77% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N] Delta
..R..........DHG--...................N............      45      3     23     19      0      0      0      0      45     32  71% [T19R,G142D,Y145H,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.V.......A.........N............      45      0     34      1      0     10      0      0      45     31  68% [T19R,G142D,E156G,F157-,R158-,G181V,L452R,T478K,E484A,D614G,P681R,D950N] 
..R...F...I...HG--...V...............N............      45     16     28      1      0      0      0      0      45     40  88% [T19R,V36F,T95I,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
F.R..........D.G--...............L...N............      45     42      1      2      0      0      0      0      45     45 100% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812L,D950N] Delta
..RS.........D.G--...................N...Y........      45      0      0     45      0      0      0      0      45     43  95% [T19R,P26S,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
F.R.......I..D.G--........V..........N............      44     35      9      0      0      0      0      0      44     31  70% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,A262S,G446V,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--...........H.......N............      44      9     14      7      2      0     10      2      44     37  84% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N] 
..I.......I..D.G--...................N............      44     35      5      0      3      0      0      1      44     32  72% [T19I,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..........I..D.G--...................N............      44     10     13     21      0      0      0      0      44     35  79% [T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--.....H.............N............      44      7      0     37      0      0      0      0      44     42  95% [T19R,T95I,G142D,E156G,F157-,R158-,P251H,L452R,T478K,D614G,P681R,D950N] 
..R............G--...................N........V...      43      3     10     29      0      0      1      0      43     37  86% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219V] Delta
..R............G--.V.......A.........N............      43      0     43      0      0      0      0      0      43     42  97% [T19R,E156G,F157-,R158-,G181V,L452R,T478K,E484A,D614G,P681R,D950N] 
......................--............N.............      42      0      0      0      0      0     42      0      42     16  38% [G75V,T76I,R246N,S247-,Y248-,L249-,T250-,P251-,G252-,D253-,L452Q,F490S,D614G,T859N] Lambda
..R.......I...HG--...V...............N...........L      42     33      6      3      0      0      0      0      42     24  57% [T19R,T95I,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+Y145H,V1264L
..R............G--...............L...N............      41      5     14     19      2      0      1      0      41     33  80% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812L,D950N] Delta
..R............G--......L............N............      41      0     11     22      1      0      7      0      41     35  85% [T19R,E156G,F157-,R158-,W258L,L452R,T478K,D614G,P681R,D950N] 
..R............G--..Y................N............      41      0      5     28      2      1      5      0      41     29  70% [T19R,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--G..................N............      41      0      0     41      0      0      0      0      41     39  95% [T19R,G142D,E156G,F157-,R158-,E180G,L452R,T478K,D614G,P681R,D950N] Delta
.FR..........D.G--...V.......H.......N............      40      0      1     39      0      0      0      0      40     28  70% [L18F,T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T95_,A222V
..R............G--...V...I........................      39      0      0     39      0      0      0      0      39     32  82% [T19R,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R] 
..R.......I..D.G--.V...........H.....N............      39     26     13      0      0      0      0      0      39     31  79% [T19R,T95I,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R............G--...................N.........I..      39      0      8     29      1      0      1      0      39     29  74% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237I] Delta
..R.......I....G--.........Q.........N....L.......      39      1     29      7      0      2      0      0      39     35  89% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,D950N,V1104L] Delta+E484Q
..R..A.......D.G--....I.L....H.......N............      39      0     39      0      0      0      0      0      39     30  76% [T19R,T29A,G142D,E156G,F157-,R158-,T250I,W258L,T299I,L452R,T478K,Q613H,D614G,P681R,D950N] 
I.R..........D.G--...................N............      39      0      0     39      0      0      0      0      39     36  92% [L5I,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..RS......I....G--...................N............      38      4     23     11      0      0      0      0      38     16  42% [T19R,P26S,L54F,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...................NV...........      38      0     27      6      0      0      5      0      38     31  81% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020V] Delta
..R...............................................      38      0     33      0      0      0      5      0      38     19  50% [T19R,L452R,T478K,D614G,P681R] 
F.R.......I..D.G--.................L.N............      38      0     38      0      0      0      0      0      38     22  57% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R.......I..D.G--....N..............N............      37     37      0      0      0      0      0      0      37     28  75% [T19R,T95I,G142D,E156G,F157-,R158-,T250N,L452R,T478K,N532S,D614G,A653V,P681R,D950N] 
..R.......I....G--...................N........V...      37      3      6      2      2      0     24      0      37     21  56% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219V] Delta
..R.....L....D.G--...V........K......N............      37      0     37      0      0      0      0      0      37     37 100% [T19R,V70L,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q675K,P681R,D950N] 
.FR..........D.G--...V...............N...........L      37     18      6     13      0      0      0      0      37     17  45% [N17K,L18F,T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,P499R,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I....G--Q..V...............N............      36      0     36      0      0      0      0      0      36     36 100% [T19R,T95I,E156G,F157-,R158-,E180Q,A222V,L452R,T478K,D614G,P681R,D950N] 
F.R............G--................................      36      0     10     20      0      0      6      0      36     29  80% [L5F,T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
..R............G--.........A.........N............      36      0     33      1      1      0      1      0      36     34  94% [T19R,E156G,F157-,R158-,L452R,T478K,E484A,D614G,P681R,D950N] 
..R.....I......G--................................      36      0      1     35      0      0      0      0      36     19  52% [T19R,V70I,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
F.R..........D.G--...V...............N...........L      36      0      1     35      0      0      0      0      36     20  55% [L5F,T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I....G--..Y................N............      36      2     13     16      4      0      1      0      36     26  72% [T19R,T95I,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N] Delta
..................................................      35      1     16     15      1      2      0      0      35      8  22% [D614G] 
..RS......I....G--...................N...Y........      35      0     34      0      0      0      0      1      35     34  97% [T19R,P26S,L54F,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
..R..........D.G--...................N......W.....      35      1      0     34      0      0      0      0      35     31  88% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,L1141W] Delta
F.R.......I....G--.................L.N............      35      1     34      0      0      0      0      0      35     27  77% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R...F...I..DHG--...V...............N.......S....      35     35      0      0      0      0      0      0      35     32  91% [T19R,V36F,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,P1162S] Delta+Y145H,A222V
..R............G--......R............N............      34      0     32      2      0      0      0      0      34     10  29% [T19R,E156G,F157-,R158-,W258R,L452R,T478K,D614G,P681R,D950N] 
.FR.......I..D.G--...................N..........Y.      34      3     31      0      0      0      0      0      34     30  88% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259Y] Delta
..R..........D.G--....I..............N............      34      5     11     18      0      0      0      0      34     18  52% [T19R,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N] 
F.R............G--...V...I...........N............      34      0      0     34      0      0      0      0      34     29  85% [L5F,T19R,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V,V289I
..R.......I..D.G--.V.................N...........A      34     34      0      0      0      0      0      0      34     31  91% [T19R,T95I,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N,V1264A] 
..R.......I..D.G--.....T.............N....L.......      34      0      0     34      0      0      0      0      34     33  97% [T19R,T95I,G142D,E156G,F157-,R158-,P251T,L452R,T478K,D614G,P681R,D950N,V1104L] 
..R.......I..DHG--.V.V...............N............      33     33      0      0      0      0      0      0      33     25  75% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,G181V,A222V,L452R,T478K,D614G,P681R,D950N,L1049I,M1233I] Delta+Y145H,A222V
F.R............G--..Y................N............      33      0     33      0      0      0      0      0      33     29  87% [L5F,T19R,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N,G1167V] Delta
F.R.......I..DHG--...V...............N...........L      33     33      0      0      0      0      0      0      33     13  39% [L5F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+Y145H,V1264L
..R..........D.G--...................N..T.........      33      1      0     32      0      0      0      0      33     22  66% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078T] Delta
..R.......I..DHG--...V...............N.....V......      33     31      2      0      0      0      0      0      33     19  57% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1124V] Delta+Y145H,A222V
..R.......I..D.G--.R.................N............      33     18     11      4      0      0      0      0      33     30  90% [T19R,T95I,G142D,E156G,F157-,R158-,G181R,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--.........A.........N............      32      1      6     25      0      0      0      0      32     25  78% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,E484A,D614G,P681R,D950N] 
..R.......I..D.G--...................N.......A....      32      2      0      0      0      0      0     30      32     28  87% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162A] Delta
.FR.......I..D.G--...................N.....V......      32     32      0      0      0      0      0      0      32     32 100% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124V] Delta
F.R.......I..DHG--...V...............N.......S....      32     20     12      0      0      0      0      0      32     30  93% [L5F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,Q779E,D950N,P1162S] Delta+Y145H,A222V
..R..........D.G--.A.................N............      32      2     11     19      0      0      0      0      32     25  78% [T19R,G142D,E156G,F157-,R158-,G181A,L452R,T478K,D614G,P681R,D950N] Delta
.FR.......I..D.G--...................N......F.....      32     32      0      0      0      0      0      0      32     14  43% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,L1141F] Delta
..R....S.......G--...................N............      32      2     24      5      0      0      1      0      32     26  81% [T19R,A67S,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..................V...............N............      31      0      2      6     23      0      0      0      31     19  61% [T19R,A222V,L452R,T478K,D614G,P681R,D950N] 
..R.......I........................L.N............      31      0     31      0      0      0      0      0      31     18  58% [T19R,T95I,L452R,T478K,D614G,P681R,I850L,D950N] 
..R.......I..D.G--..............S..L.N............      31      1     30      0      0      0      0      0      31     29  93% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,I850L,D950N] Delta
..R.......I....G--.................L.N...........L      31      1     29      0      1      0      0      0      31     28  90% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N,V1264L] Delta+V1264L
..R............G--...................N.........V..      31      0     25      6      0      0      0      0      31     29  93% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237V] Delta
..R.......I..DHG--...V....S..........N............      31     31      0      0      0      0      0      0      31     30  96% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,G446S,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R..........D.G--...V.......HH......N............      31      0      0     31      0      0      0      0      31     31 100% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R............G--..H................N............      30      0      5     25      0      0      0      0      30     14  46% [T19R,E156G,F157-,R158-,D215H,L452R,T478K,D614G,P681R,D950N] Delta
..R.....F.I....G--...................N............      30      6     19      4      0      0      1      0      30     28  93% [T19R,V70F,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.V--..............L....N............      30     30      0      0      0      0      0      0      30     24  80% [T19R,T95I,G142D,E156V,F157-,R158-,L452R,T478K,D614G,P681R,P809L,D950N] 
F.R.......I..D.G--..............S....N............      30      0      1     29      0      0      0      0      30     20  66% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N] Delta
..R.......I..DHG--...V...............N........V...      30     23      7      0      0      0      0      0      30     28  93% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1219V] Delta+Y145H,A222V
..R...I......D.G--...................N..S.........      30     30      0      0      0      0      0      0      30     29  96% [T19R,V36I,G142D,E156G,F157-,R158-,D253G,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R............G--.....L..........................      29      0     24      5      0      0      0      0      29     23  79% [T19R,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R] 
..R....V.....D.G--...V.......H.......N............      29      0      3     26      0      0      0      0      29     25  86% [T19R,A67V,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...V............................      29      0      8      0     20      0      1      0      29     25  86% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R] 
..R.......I....G--...V.............L.N............      29      0     29      0      0      0      0      0      29     27  93% [T19R,T95I,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,I850L,D950N] 
..R..........D.G--.V.................N..........Y.      29     17     11      0      0      0      1      0      29     21  72% [T19R,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N,D1259Y] Delta
..R..........D.G--.......L.....H.....N............      29      0      0     29      0      0      0      0      29     27  93% [T19R,G142D,E156G,F157-,R158-,V289L,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R............G--........V..H.......N............      29      0     29      0      0      0      0      0      29     29 100% [T19R,E156G,F157-,R158-,G446V,L452R,T478K,Q613H,D614G,S640F,P681R,D950N] 
..R....V..I..DHG--...V...............N............      29     29      0      0      0      0      0      0      29     28  96% [T19R,A67V,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R.....I....D.G--.............H.....N............      28      0      0     28      0      0      0      0      28     27  96% [T19R,V70I,G142D,E156G,F157-,R158-,M177I,L452R,T478K,D614G,Q677H,P681R,D950N] 
..R..........D.......................N...........L      28      0      4      0     23      1      0      0      28     14  50% [T19R,G142D,L452R,T478K,D614G,P681R,D950N,V1264L] 
F.R..........D.G--...V...I...........N............      28      0      1     27      0      0      0      0      28     23  82% [L5F,T19R,G142D,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V,V289I
..R.......I..D.G--..............S....NS...........      28      0      0     28      0      0      0      0      28     25  89% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N,A1020S] Delta
..R............G--............H......N............      28      0      8     16      1      0      3      0      28     27  96% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R.......I....G--...................N......F.....      28     14      5      9      0      0      0      0      28     20  71% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,L1141F] Delta
..R..........D.G--...................N.........V..      28      2     10     15      1      0      0      0      28     24  85% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237V] Delta
..R.......I..DHG--...V...............N........C...      28     23      5      0      0      0      0      0      28     25  89% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1219C] Delta+Y145H,A222V
.FR.......I..D.G--.E.................N............      28     28      0      0      0      0      0      0      28     28 100% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,G181E,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...................N.....V.....L      28      0     27      0      1      0      0      0      28     28 100% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124V,V1264L] Delta+V1264L
..R.......IL.D.G--...................N............      28      5      3     20      0      0      0      0      28     22  78% [T19R,T95I,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R.....F.I..D.G--...................N...Y........      28     28      0      0      0      0      0      0      28     28 100% [T19R,V70F,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] 
..R.......V..D.G--...................N............      28     20      2      6      0      0      0      0      28     28 100% [T19R,T95V,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--...V.......H.......N............      27      0     10      6     11      0      0      0      27     10  37% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I..D.G--.A.................N............      27     20      6      0      1      0      0      0      27     14  51% [T19R,T95I,G142D,E156G,F157-,R158-,G181A,V367I,L452R,T478K,D614G,P681R,D950N] Delta
F.R.......I..D.G--...................N......F.....      27     20      7      0      0      0      0      0      27     26  96% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,L1141F] Delta
..R.......I..D.G--........S..........N............      27     11      7      8      1      0      0      0      27     23  85% [T19R,T95I,G142D,E156G,F157-,R158-,G446S,L452R,T478K,D614G,P681R,D950N] Delta
.FR........L.D.G--...................N............      27      1      0     26      0      0      0      0      27     22  81% [L18F,T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
F.R........L...G--...................N............      27      0      0     27      0      0      0      0      27     22  81% [L5F,T19R,S112L,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R..........D.G--...................N......F.....      27     22      0      5      0      0      0      0      27     25  92% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,L1141F] Delta
..R.V..........G--...................N............      27      0      6     14      3      0      4      0      27     26  96% [T19R,A27V,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N..V.........      27     10      0     17      0      0      0      0      27     11  40% [T19R,T95I,G142D,E156G,F157-,R158-,A262G,L452R,T478K,D614G,P681R,D950N,A1078V] Delta
..R.......I.HD.G--V..................N............      27      0     27      0      0      0      0      0      27     25  92% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,E180V,L452R,T478K,D614G,P681R,D950N,I1114T] Delta
..R.......I..DHG--..YV...............N............      27     27      0      0      0      0      0      0      27     11  40% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,D215Y,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..RR.........D.G--...................N............      27      0      0     27      0      0      0      0      27     21  77% [T19R,P26R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--..................NN............      26      1     16      8      1      0      0      0      26     19  73% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859N,D950N] Delta
..R.......I.HD.G--..............Q....N............      26     26      0      0      0      0      0      0      26     19  73% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,A522S,D614G,P681R,P809Q,D950N] Delta
..R............G--...V.........H.....N............      26      0     15      8      3      0      0      0      26     22  84% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R.......I..D.G--..............L....N............      26     15      1      2      0      0      0      8      26     25  96% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809L,D950N] Delta
F.R..........D.G--..........I........N............      26      0      9     17      0      0      0      0      26     25  96% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,T572I,D614G,P681R,D950N] Delta
..R.....I......G--.............H.....N............      26      0      0     26      0      0      0      0      26     25  96% [T19R,V70I,E156G,F157-,R158-,M177I,L452R,T478K,D614G,Q677H,P681R,D950N] 
..R..........D.G--...V...............N.T..........      26      4     22      0      0      0      0      0      26     23  88% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,K1073T] Delta+T95_,A222V
..R..........D.G--..............L....N............      26      2      2     22      0      0      0      0      26     22  84% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809L,D950N] Delta
..R.......I..DHG--...V....V..........N............      26     25      1      0      0      0      0      0      26     18  69% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,G446V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R.......I..D.G--..............L....N...........L      26     26      0      0      0      0      0      0      26     26 100% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809L,D950N,V1264L] Delta+V1264L
..R......YI....G--...................N............      25      4      8      8      5      0      0      0      25     15  60% [T19R,D80Y,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.E.V...............N............      25      0     25      0      0      0      0      0      25     15  60% [T19R,G142D,E156G,F157-,R158-,G181E,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I..D.G--........................L.......      25      0      5     15      1      0      4      0      25     10  40% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,V1104L] 
..R.......I..D.G--.............H....IN..........H.      25      0      5     20      0      0      0      0      25     18  72% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,T859I,D950N,D1259H] Delta+FurinRelated
..R.......I..D.G--............R......N............      25     24      0      1      0      0      0      0      25     13  52% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675R,P681R,A688V,D950N] Delta+FurinRelated
..R.......I....G--............................C...      25      0     24      1      0      0      0      0      25     23  92% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,Q787K,G1219C] 
..R.......I..D.G--.................V.N............      25     24      1      0      0      0      0      0      25     22  88% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850V,D950N] Delta
..RLS.....I..D.G--...................N............      25     25      0      0      0      0      0      0      25     18  72% [T19R,P26L,A27S,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--..E................N............      25      1      0     24      0      0      0      0      25     23  92% [T19R,T95I,G142D,E156G,F157-,R158-,D215E,L452R,T478K,D614G,P681R,D950N] Delta
..R........L.D.G--...................N....L.......      25      0      0     25      0      0      0      0      25     25 100% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta+S112L
..R..........D.G--......F............N............      25      0      0     25      0      0      0      0      25     25 100% [T19R,G142D,E156G,F157-,R158-,W258F,L452R,T478K,D614G,P681R,D950N] 
..R............G--...................N..........E.      24      0     23      1      0      0      0      0      24     23  95% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259E] Delta
..R............G--...................N..........Y.      24      0     20      4      0      0      0      0      24     21  87% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259Y] Delta
..R............G--...................N.......S....      24      0     10     11      0      0      3      0      24     17  70% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] Delta
F.R.......I..D.G--.V.................N............      24      1     23      0      0      0      0      0      24     24 100% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--..............S.................      24      0      0     24      0      0      0      0      24     20  83% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S] 
..R..........D.G--...................N........S...      24      5     10      9      0      0      0      0      24     23  95% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219S] Delta
..R.......I..D.G--...................N........S...      24     23      0      1      0      0      0      0      24     21  87% [T19R,T95I,G142D,E156G,F157-,R158-,R408I,L452R,T478K,D614G,P681R,D950N,G1219S] Delta
..R.......I..D.G--...P...............N............      24      8      3     13      0      0      0      0      24     19  79% [T19R,T95I,G142D,E156G,F157-,R158-,A222P,L452R,T478K,D614G,P681R,D950N] 
F.R.......I..D.G--...................N....L.......      23      4      2     17      0      0      0      0      23      7  30% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
........-..................K......................      23      0      1      0     22      0      0      0      23     10  43% [H69-,V70-,Y144-,E484K,N501Y,A570D,D614G,P681H,T716I,S982A,D1118H] Alpha+E484K
............---.....................N.............      23      0     22      1      0      0      0      0      23     12  52% [P9L,E96Q,C136-,N137Y,D138-,P139-,F140-,L141-,G142-,V143-,Y144-,Y145-,R190S,I210T,R346S,N394S,Y449N,F490R,N501Y,D614G,P681H,T859N,D936H] 
..R..........D.G--.....L.............N..S.........      23      0     23      0      0      0      0      0      23     19  82% [T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N,A1078S] Delta+T95_,P251L
F.R.......I..D.G--................S..N............      23     23      0      0      0      0      0      0      23     21  91% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,P479S,D614G,P681R,A845S,D950N] Delta
F.R..........D.G--.....L.............N............      23      8      9      6      0      0      0      0      23     11  47% [L5F,T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R....V.....D.G--...V...............N...........L      23      0      0     23      0      0      0      0      23     15  65% [T19R,A67V,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I..D.G--.................L.N..........H.      23      0     23      0      0      0      0      0      23     15  65% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N,D1259H] Delta
..R..........D.G--.........K.........N............      23     10      9      3      0      1      0      0      23     17  73% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,E484K,D614G,P681R,D950N] 
..R..........D.G--...V..L............N............      23      1      6     16      0      0      0      0      23     11  47% [T19R,G142D,E156G,F157-,R158-,A222V,W258L,L452R,T478K,D614G,P681R,D950N] 
-.R.......I..D.G--...................N............      23      0     22      1      0      0      0      0      23      9  39% [L5-,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--.........Q........NN............      23      0     23      0      0      0      0      0      23     23 100% [T19R,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,V687I,T859N,D950N] Delta+E484Q
..R.......I..D.G--...................N.....C......      23      5     17      1      0      0      0      0      23     23 100% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124C] Delta
..R..........D.G--.V....R............N............      23      0     23      0      0      0      0      0      23     12  52% [T19R,G142D,E156G,F157-,R158-,G181V,W258R,L452R,T478K,D614G,P681R,D950N,S1242I] 
..R........L.D.G--........V..........N............      22      0      0     22      0      0      0      0      22     18  81% [T19R,S112L,G142D,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R.......I..D.G--.V.................N....L.......      22      1      9     12      0      0      0      0      22     11  50% [T19R,T95I,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R..........D.G--...................N..V.........      22      5      3     13      0      0      1      0      22     17  77% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078V] Delta
..R............G--K..................N............      22      0      0     22      0      0      0      0      22     16  72% [T19R,E156G,F157-,R158-,E180K,L452R,T478K,D614G,P681R,D950N] Delta
..R.....-....D.G--..N................N...........L      22      0      0      0     22      0      0      0      22     15  68% [T19R,H69-,V70-,G142D,E156G,F157-,R158-,D215N,L452R,T478K,D614G,P681R,D950N,V1264L] 
..R..........D-G--...................N............      22      1      3     12      6      0      0      0      22      9  40% [T19R,G142D,V143-,Y144-,Y145-,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..A.......D.G--....I..............N.........I..      22     22      0      0      0      0      0      0      22     22 100% [T19R,T29A,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N,M1237I] Delta+T29A,T95_,T250I
..R............G--...V.......H.......N...........L      22      0     15      6      0      0      1      0      22     17  77% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N,N1074S,V1264L] Delta+N1074S,V1264L
..R.......I..DHG--...V...............N.....V.....L      22     22      0      0      0      0      0      0      22     22 100% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1124V,V1264L] Delta+Y145H,V1264L
..R.......I....G--..................NN............      22      2     10      7      3      0      0      0      22     20  90% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859N,D950N] Delta
F.R.....F.I..D.G--...................N............      22     22      0      0      0      0      0      0      22     22 100% [L5F,T19R,V70F,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R......Y...D.G--......R............N..S.........      22     22      0      0      0      0      0      0      22     21  95% [T19R,D80Y,G142D,E156G,F157-,R158-,W258R,L452R,T478K,D614G,P681R,D950N,A1078S] 
..R..........D.G--...V.........H.....N............      21      1     17      3      0      0      0      0      21     15  71% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R..A.......D.G--....I......H.......N..........H.      21      0     21      0      0      0      0      0      21      8  38% [T19R,T29A,G142D,E156G,F157-,R158-,T250I,T299I,L452R,T478K,V511I,Q613H,D614G,P681R,D950N,D1259H] Delta+T29A,T95_,T250I,T299I,Q613H
..R............G--...........H....................      21      0      9     11      0      0      1      0      21     11  52% [T19R,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R] 
..R.......I..DHG--...V...........L...N............      21     19      2      0      0      0      0      0      21     10  47% [T19R,R21T,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,P812L,D950N] Delta+Y145H,A222V
..R........F.D.G--...................N............      21      0      0     21      0      0      0      0      21      9  42% [T19R,S112F,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,G838S,D950N] 
F.R..........D.G--...................N........V...      21     10     11      0      0      0      0      0      21     13  61% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219V] Delta
..R.......I..D.G--G..................N....L.......      21      0      0     21      0      0      0      0      21     19  90% [T19R,T95I,G142D,E156G,F157-,R158-,E180G,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R.......I....G--...................N........C...      21      1      7     12      1      0      0      0      21     13  61% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219C] Delta
..R.......I....G--...........H.....L.N............      21      0     21      0      0      0      0      0      21     20  95% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,I850L,D950N] 
F.R............G--...V...............N............      21      0     12      3      6      0      0      0      21     16  76% [L5F,T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I....G--..................IN............      21      2      4     11      3      0      0      1      21     12  57% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,T859I,D950N] Delta
..R.......I....G--.........K.........N............      21      4     13      1      2      0      0      1      21     13  61% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,E484K,D614G,P681R,D950N] 
..R.......I..DHG--...V...L...........N............      21     21      0      0      0      0      0      0      21     21 100% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,V289L,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R..........D.G--...V...............NS..........L      21      0      0     21      0      0      0      0      21     18  85% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,A1020S,V1264L] Delta+V1264L
..R.........VD.G--...................N............      21      0     21      0      0      0      0      0      21     18  85% [T19R,D138V,G142D,E156G,F157-,R158-,T323K,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.......L...........N............      20     12      3      5      0      0      0      0      20     11  55% [T19R,G142D,E156G,F157-,R158-,V289L,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.V.................N..........H.      20      0     20      0      0      0      0      0      20     16  80% [T19R,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N,D1259H] Delta
..R.......I..D.G--.........Q...H.....N............      20      7     11      2      0      0      0      0      20     19  95% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R.......I..D.G--...................N...N........      20     20      0      0      0      0      0      0      20     18  90% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101N] Delta
..R.......I....G--............H...................      20      0      0     20      0      0      0      0      20     14  70% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R] 
..R....V..I....G--...................N............      20      5      4      7      4      0      0      0      20     18  90% [T19R,A67V,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--.V..........H......N............      20      0      0     20      0      0      0      0      20     19  95% [T19R,T95I,G142D,E156G,F157-,R158-,G181V,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R.......I..DHG--...V........R......N............      20     20      0      0      0      0      0      0      20     17  85% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q675R,P681R,D950N] Delta+FurinRelated
..R.....I....D.G--...................N..........Y.      20      3      0     17      0      0      0      0      20     19  95% [T19R,V70I,G142D,E156G,F157-,R158-,M177I,L452R,T478K,D614G,P681R,D950N,D1259Y] 
..R.......I..D.G--..........N......L.N............      20      1     19      0      0      0      0      0      20     20 100% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,T572N,D614G,P681R,I850L,D950N] Delta
..R.......I..D.G--.............H.....NS...........      20     19      1      0      0      0      0      0      20     17  85% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E583D,D614G,Q677H,P681R,D950N,A1020S,I1132V] Delta+FurinRelated
F.R.......I..D.G--VV.................N............      20     20      0      0      0      0      0      0      20     19  95% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,E180V,G181V,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.........Q........NN............      20      1     19      0      0      0      0      0      20     18  90% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R,V687I,T859N,D950N] Delta+E484Q
..R.....G.I..D.G--...................N............      20     12      8      0      0      0      0      0      20     12  60% [T19R,V70G,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
F.R............G--...V...............N...........L      19      0      1     18      0      0      0      0      19     14  73% [L5F,T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R............G--...................N.......R....      19      0      0     19      0      0      0      0      19     18  94% [T19R,E156G,F157-,R158-,Q173H,L452R,T478K,D614G,P681R,D950N,P1162R] Delta
F.R.......I....G--...................N....L.......      19      0      0     18      0      0      1      0      19     10  52% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R.......I....G--.............H....IN............      19      1     17      0      0      0      1      0      19     10  52% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,T859I,D950N] Delta+FurinRelated
..R.......I..D.G--..............S....N........C...      19     19      0      0      0      0      0      0      19     15  78% [T19R,T95I,G142D,E156G,F157-,R158-,K417N,L452R,T478K,D614G,P681R,P809S,D950N,G1219C] 
..R..........D.G--.V....R....H.......N............      19      0     19      0      0      0      0      0      19     16  84% [T19R,G142D,E156G,F157-,R158-,G181V,W258R,L452R,T478K,Q613H,D614G,P681R,D950N,S1242I] 
..R..........D.G--...................N.T..........      19      0      0     19      0      0      0      0      19     18  94% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073T] Delta
..R..........D.G--...V..........S....N...........L      19      0      0     19      0      0      0      0      19     19 100% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,P809S,D950N,V1264L] Delta+V1264L
..R.V........D.G--.....L.............N............      19      0      9     10      0      0      0      0      19     14  73% [T19R,A27V,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R.......I..D.G--...................N.....S......      19     18      0      1      0      0      0      0      19     18  94% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1124S] Delta
..R...F...I.HDHG--...V...............N............      19     19      0      0      0      0      0      0      19     18  94% [T19R,V36F,T95I,D138H,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..I............G--...................N............      18      0      0     18      0      0      0      0      18     15  83% [T19I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
-.R..........D.G--...................N............      18      0     18      0      0      0      0      0      18     15  83% [L5-,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--........S..........N............      18      0      2     15      0      0      1      0      18      9  50% [T19R,E156G,F157-,R158-,G446S,L452R,T478K,D614G,P681R,D950N] Delta
.FR..........D.G--...V...............N............      18      0      1     17      0      0      0      0      18     18 100% [L18F,T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I....G--..............S..L.N............      18      0     18      0      0      0      0      0      18     18 100% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,I850L,D950N] Delta
..R............G--................S...............      18      0     15      2      1      0      0      0      18     14  77% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S] 
F.R..........D.G--............H......N............      18      0      0     18      0      0      0      0      18     18 100% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R.......I.HD.G--...................N....L.......      18      1      0     17      0      0      0      0      18     15  83% [T19R,T95I,K97E,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R............G--......................S.........      18      0     14      4      0      0      0      0      18     10  55% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A1078S] 
..R..........D.G--...V.....Q.........N............      18      1     15      0      2      0      0      0      18      9  50% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,E484Q,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I....G--...............S...N............      18      2      5      9      2      0      0      0      18     15  83% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,D950N] Delta
..R...........HG--...................N............      18      0      8      7      3      0      0      0      18     11  61% [T19R,Y145H,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...V....V..........N............      18      1      8      6      3      0      0      0      18     12  66% [T19R,G142D,E156G,F157-,R158-,A222V,G446V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...........H.......NS...........      18      1     13      0      4      0      0      0      18     13  72% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N,A1020S] 
..R.......I..DHG--...V.......H.......N...........L      18     18      0      0      0      0      0      0      18     17  94% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N,V1264L] Delta+Y145H,V1264L
..RH......I....G--...................N............      18      0     18      0      0      0      0      0      18     18 100% [T19R,P26H,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..DHG--...V...............NS...........      18     17      1      0      0      0      0      0      18     14  77% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,A1020S] Delta+Y145H,A222V
-.R.......I..DHG--...V...............N.......S....      18      0     18      0      0      0      0      0      18     18 100% [L5-,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,Q779E,D950N,V1122L,P1162S] Delta+Y145H,A222V
..R............G--..E................N............      18      0      0     18      0      0      0      0      18     17  94% [T19R,E156G,F157-,R158-,Q183Y,D215E,A352S,L452R,T478K,D614G,P681R,D950N] Delta
.FR..A....I..D.G--...................N..........Y.      18      0     18      0      0      0      0      0      18     17  94% [N17K,L18F,T19R,T29A,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259Y] 
..R............G--..G................N............      17      0      1     16      0      0      0      0      17     15  88% [T19R,E156G,F157-,R158-,D215G,L452R,T478K,D614G,P681R,D950N] Delta
..R..A.......D.G--....I..............N.......L....      17      0     17      0      0      0      0      0      17     14  82% [T19R,T29A,G142D,E156G,F157-,R158-,P174S,T250I,L452R,T478K,D614G,P681R,D950N,P1162L] Delta+T29A,T95_,T250I
..R............G--.................L.N............      17      1     16      0      0      0      0      0      17     12  70% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R.........Y..G--...................N............      17      0      0      2      0      0     15      0      17     10  58% [T19R,D138Y,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--...............L...N............      17      4      6      7      0      0      0      0      17     10  58% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812L,D950N] Delta
..R............G--.............H..................      17      0      7     10      0      0      0      0      17     14  82% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R] 
..R.......I..D.G--.........D.........N............      17      9      2      4      0      0      2      0      17     15  88% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484D,D614G,P681R,D950N] 
..R.......I..D.G--...T...............N............      17     15      1      1      0      0      0      0      17     14  82% [T19R,T95I,G142D,E156G,F157-,R158-,A222T,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--........R..........N............      17      4      9      3      1      0      0      0      17      9  52% [T19R,G142D,E156G,F157-,R158-,G446R,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...........H.......N....L.......      17      1      8      8      0      0      0      0      17     14  82% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N,V1104L] 
.FR..........D.G--...................N.........I..      17     17      0      0      0      0      0      0      17     15  88% [L18F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,L938F,D950N,M1237I] Delta
..R..........D.G--...................N.........L..      17      0      0     17      0      0      0      0      17     17 100% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237L] Delta
..R..........D.G--.....L.......H.....N............      16      1     15      0      0      0      0      0      16     15  93% [T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R.......I..D.G--.............H.....N..........H.      16      0     16      0      0      0      0      0      16     10  62% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N,D1259H] Delta+FurinRelated
..R........L.D.G--...........H.......N............      16      0      0     16      0      0      0      0      16     15  93% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+S112L
.IR........L.D.G--...................N............      16      0      0     16      0      0      0      0      16      9  56% [L18I,T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R.......I..D.G--....S..............N............      16     16      0      0      0      0      0      0      16     14  87% [T19R,T95I,G142D,E156G,F157-,R158-,T250S,L452R,T478K,D614G,P681R,L938F,D950N] 
..RL......I....G--...................N............      16      0     10      4      2      0      0      0      16      7  43% [T19R,P26L,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R........L.D.G--.........A.........N............      16      0      0     16      0      0      0      0      16     16 100% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,E484A,D614G,P681R,D950N] 
..R..........D.G--.V...L.............N............      16     14      2      0      0      0      0      0      16      9  56% [T19R,G142D,E156G,F157-,R158-,G181V,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R......HI..D.G--...................N............      16     14      1      1      0      0      0      0      16     15  93% [T19R,D80H,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
F.R.......I..D.G--V..................N............      16     16      0      0      0      0      0      0      16     13  81% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,E180V,L452R,S459F,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--................S..N....L.......      16      7      7      2      0      0      0      0      16     14  87% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N,V1104L] Delta
..I............G--................S..N............      16      0     16      0      0      0      0      0      16     16 100% [T19I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S,D950N,G1167V] 
.....................................N....L.......      16      0      0     16      0      0      0      0      16      5  31% [L452R,T478K,D614G,P681R,D950N,V1104L] 
..R.........GD.G--...................N............      16      4      1     11      0      0      0      0      16     11  68% [T19R,D138G,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D...G...................N............      16      0     16      0      0      0      0      0      16     15  93% [T19R,T95I,G142D,R158G,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--...............S.L.N............      16      0     16      0      0      0      0      0      16     15  93% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,I850L,D950N] Delta
..R.....F..L.D.G--...................N............      16      1      0     15      0      0      0      0      16     14  87% [T19R,V70F,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R.......I..DHG--...V...............N..V.........      16     16      0      0      0      0      0      0      16     13  81% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,A1078V] Delta+Y145H,A222V
..R.S........D.G--......R............N............      16      0     16      0      0      0      0      0      16     13  81% [T19R,A27S,G142D,E156G,F157-,R158-,W258R,L452R,T478K,D614G,V622F,P681R,D950N] 
..R....S..I....G--...................N............      15      0      3     10      2      0      0      0      15      9  60% [T19R,A67S,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..A.......D.G--...................N............      15      0      7      7      0      0      1      0      15      8  53% [T19R,T29A,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R........L.D.G--...................N.....V......      15      0      0     15      0      0      0      0      15      9  60% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,T547I,D614G,P681R,D950N,G1124V] Delta+S112L
..R.......I..D.G--.......I...........N............      15     10      3      2      0      0      0      0      15     10  66% [T19R,T95I,G142D,E156G,F157-,R158-,V289I,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I....G--...................N.......L....      15      1      2     12      0      0      0      0      15     11  73% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162L] Delta
..R..........D.G--.......I...........N............      15      1      6      8      0      0      0      0      15     12  80% [T19R,G142D,E156G,F157-,R158-,V289I,L452R,T478K,D614G,P681R,D950N] Delta
..R...F......D.G--...................N............      15      0      1     14      0      0      0      0      15      7  46% [T19R,V36F,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R............G--.V..............................      15      0     11      4      0      0      0      0      15     10  66% [T19R,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R] 
..R.V...I....D.G--...................N............      15      0      0     15      0      0      0      0      15     12  80% [T19R,A27V,V70I,G142D,E156G,F157-,R158-,M177I,L452R,T478K,D614G,P681R,D950N] 
..R..S....I..D.G--...................N............      15      3      0     12      0      0      0      0      15     11  73% [T19R,T29S,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
F.R.......I....G--..............S....N............      15      0      0     15      0      0      0      0      15     12  80% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N] Delta
..R..........D.G--...........H.......N........C...      15      0      1     14      0      0      0      0      15     13  86% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N,G1219C] 
.FR.......I..D.G--.................L.N............      15      3     12      0      0      0      0      0      15      7  46% [L18F,T19R,T95I,G142D,E156G,F157-,R158-,E281Q,L452R,T478K,Y508H,D614G,P681R,I850L,D950N] Delta
..R.......I.....--...................N............      15      0      0     15      0      0      0      0      15     15 100% [T19R,T95I,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--..E................N............      15      8      0      7      0      0      0      0      15      8  53% [T19R,G142D,E156G,F157-,R158-,D215E,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N........CI..      15     15      0      0      0      0      0      0      15     15 100% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,G1219C,M1237I] Delta
..R............G--..YV...............N............      15      0      0     15      0      0      0      0      15     10  66% [T19R,E156G,F157-,R158-,D215Y,A222V,R237S,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R...F...I..DHG--.A.V...............N............      15     15      0      0      0      0      0      0      15     14  93% [T19R,V36F,T95I,G142D,Y145H,E156G,F157-,R158-,G181A,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
FFR.......I..DHG--...V...............N...........L      15     15      0      0      0      0      0      0      15     14  93% [L5F,L18F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,H655Y,P681R,D950N,V1264L] Delta+FurinRelated
..R.......I....G--..G................N............      14      0     12      2      0      0      0      0      14      9  64% [T19R,T95I,E156G,F157-,R158-,D215G,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.V.V...............N............      14      4      6      3      1      0      0      0      14     13  92% [T19R,G142D,E156G,F157-,R158-,G181V,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...V...............N..........H.      14      0     14      0      0      0      0      0      14      7  50% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,D1259H] Delta+T95_,A222V
..R..........D.G--...V...............N....L......L      14      0      0     14      0      0      0      0      14      6  42% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1104L,V1264L] Delta+V1264L
..R............G--...V.....Q.........N...........L      14      0      0      0      0      0     14      0      14     14 100% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,E484Q,D614G,P681R,D950N,T1009S,V1264L] Delta+V1264L
..R.......I..Y.G--...................N............      14     10      3      1      0      0      0      0      14     11  78% [T19R,T95I,G142Y,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
F.R..........D.G--...................N..........H.      14      0     14      0      0      0      0      0      14     12  85% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259H] Delta
F.R.....I....D.G--...................N............      14      0      0     14      0      0      0      0      14      6  42% [L5F,T19R,V70I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--...................N.N........Y.      14      0     14      0      0      0      0      0      14     13  92% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073N,D1259Y] Delta
..R.......I..DHG--...V..L............N...........L      14     14      0      0      0      0      0      0      14      8  57% [T19R,T95I,G142D,Y145H,S155I,E156G,F157-,R158-,A222V,W258L,T299I,L452R,T478K,D614G,P681R,D950N,V1264L] 
..R.......I..D.G--...V...............N...........L      14      0      0     14      0      0      0      0      14     11  78% [T19R,T95I,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I....G--.V...........H.....N............      14      1     13      0      0      0      0      0      14     10  71% [T19R,T95I,E156G,F157-,R158-,G181V,L452R,T478K,D614G,Q677H,P681R,D950N,L1265F] Delta+FurinRelated
..R..........D.G--...V...............N........C...      14      0     14      0      0      0      0      0      14     12  85% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1219C] Delta+T95_,A222V
..R.......I....G--.................L.N..........Y.      14      0     14      0      0      0      0      0      14     13  92% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,S698L,I850L,D950N,D1259Y] Delta
..R.S.....I..D.G--...S...............N............      14      1      7      6      0      0      0      0      14     14 100% [T19R,A27S,T95I,G142D,E156G,F157-,R158-,A222S,L452R,T478K,D614G,P681R,D950N] 
..R............G--.V............................Y.      14      0     14      0      0      0      0      0      14     13  92% [T19R,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D1259Y] 
.FR.......I..DHG--...V...............N............      14     14      0      0      0      0      0      0      14     14 100% [L18F,T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+Y145H,A222V
..R..........D.G--.A.V...I...........N............      13      0      0     13      0      0      0      0      13     11  84% [T19R,G142D,E156G,F157-,R158-,G181A,A222V,V289I,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V,V289I
..R..A.......D.G--....I..............N..........H.      13      0     13      0      0      0      0      0      13      7  53% [T19R,T29A,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N,D1259H] Delta+T29A,T95_,T250I
..R..I.....L.D.G--...................N............      13      0      0     13      0      0      0      0      13     13 100% [T19R,T29I,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
.........YI.............L..K......................      13      1      1      0      0     11      0      0      13      9  69% [D80Y,T95I,Y144-,W258L,E484K,D614G,P681H,D796H] 
..R.......I....G--..............S....NS...........      13      0      0     13      0      0      0      0      13     10  76% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809S,D950N,A1020S] Delta
..R..........D.G--......C............N............      13      7      0      6      0      0      0      0      13      6  46% [T19R,G142D,E156G,F157-,R158-,W258C,G261C,L452R,T478K,D614G,V622F,P681R,D950N] 
..R............G--.V.........H.......N............      13      0     13      0      0      0      0      0      13     10  76% [T19R,E156G,F157-,R158-,G181V,L452R,T478K,Q613H,D614G,P681R,D950N] 
..R.......I..A.G--...................N............      13     13      0      0      0      0      0      0      13     12  92% [T19R,T95I,G142A,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..................................N...Y........      13      0      0     13      0      0      0      0      13     13 100% [T19R,L452R,T478K,D614G,P681R,D950N,H1101Y] 
..S..........D.G--.....L.............N............      13      0      0     13      0      0      0      0      13     13 100% [T19S,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--.................L.N............      13      0     13      0      0      0      0      0      13      6  46% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R..........Y.G--...................N............      13      2      4      7      0      0      0      0      13     12  92% [T19R,G142Y,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...V...I...........N............      13      0      0     13      0      0      0      0      13      6  46% [T19R,T95I,G142D,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--...................NS...L.......      13      0      0     13      0      0      0      0      13      5  38% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A688V,D950N,A1020S,V1104L] Delta
.....................................N...Y........      13      0      0     13      0      0      0      0      13     13 100% [L452R,T478K,D614G,P681R,D950N,H1101Y] 
F.R....V.....D.G--...................N............      13     12      0      0      1      0      0      0      13     10  76% [L5F,T19R,T22I,A67V,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...................NS.......C...      13      0      0     13      0      0      0      0      13     11  84% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S,G1219C] Delta
..R.......I....G--....................S...........      13      0     11      2      0      0      0      0      13     11  84% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A1020S] 
.FR.....I....D.G--...................N............      13      0      0     13      0      0      0      0      13     13 100% [L18F,T19R,V70I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I.H..G--...................N............      13      0      0     13      0      0      0      0      13      9  69% [T19R,T95I,D138H,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--......R............N..........H.      13      0     13      0      0      0      0      0      13      7  53% [T19R,G142D,E156G,F157-,R158-,W258R,L452R,T478K,D614G,P681R,D950N,D1259H] 
..R.......I..D.G--....I..............N......F.....      13     13      0      0      0      0      0      0      13     11  84% [T19R,T95I,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N,L1141F] 
F.R............G--...V............................      13      0      2      0     11      0      0      0      13     13 100% [L5F,T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R] 
..R.....G.I..D.G--...................N.......S....      13     13      0      0      0      0      0      0      13     13 100% [T19R,V70G,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162S] 
..R.......I.HD.G--...................N..S.........      13     10      3      0      0      0      0      0      13     13 100% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R...F...I..DHG--...V...............N...Y........      13     13      0      0      0      0      0      0      13     13 100% [T19R,V36F,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta+Y145H,A222V
..R.......F..D.G--...................N............      13      3     10      0      0      0      0      0      13     13 100% [T19R,T95F,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
.............D.......................N............      12      0     10      2      0      0      0      0      12      8  66% [G142D,L452R,T478K,D614G,P681R,D950N] 
..R............G--.......I...........N............      12      0      6      6      0      0      0      0      12      5  41% [T19R,E156G,F157-,R158-,A262S,V289I,L452R,S477I,T478K,D614G,P681R,D950N,G1167V] Delta
..R.......I..DHG--...V............S..N............      12     11      1      0      0      0      0      0      12     12 100% [T19R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,A845S,D950N] Delta+Y145H,A222V
..R.......I..D.G--.....T.............N.....V......      12     12      0      0      0      0      0      0      12     11  91% [T19R,T95I,G142D,E156G,F157-,R158-,P251T,L452R,T478K,D614G,P681R,D950N,G1124V,K1191Q] 
..R..........D.G--...V.......H.......N...........L      12      0      1     11      0      0      0      0      12      4  33% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.....F.I..DHG--.E.V...............N............      12     12      0      0      0      0      0      0      12      9  75% [T19R,V70F,T95I,G142D,Y145H,E156G,F157-,R158-,G181E,A222V,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--..........N........N............      12      1      0     11      0      0      0      0      12     10  83% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,T572N,D614G,P681R,D950N] Delta
..R.......I..D.G--...S...............N...Y........      12     12      0      0      0      0      0      0      12     11  91% [T19R,T95I,G142D,E156G,F157-,R158-,A222S,L452R,T478K,D614G,P681R,D950N,H1101Y] 
..R............G--...V...............N.T..........      12      0     12      0      0      0      0      0      12     11  91% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,K1073T] Delta+T95_,A222V
..R.S..........G--...................N...Y........      12      0      0     12      0      0      0      0      12     12 100% [T19R,A27S,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,H1101Y] Delta
..R.....A.I..D.G--...................N............      12     11      0      0      1      0      0      0      12     11  91% [T19R,V70A,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--..G................N............      12      5      2      5      0      0      0      0      12      6  50% [T19R,T95I,G142D,E156G,F157-,R158-,D215G,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...V...............N....L.......      12      0      2     10      0      0      0      0      12      8  66% [T19R,T95I,K97E,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,V1104L] 
..R.....F....D.G--...V...............N............      12      0      3      9      0      0      0      0      12      3  25% [T19R,V70F,G142D,E156G,F157-,R158-,A222V,K417N,L452R,T478K,D614G,P681R,D950N] Delta+T95_,V70F,A222V,K417N
..R......Y.....G--.....L.............N............      12      0     12      0      0      0      0      0      12     10  83% [T19R,D80Y,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R..A.........G--....I...V.......................      12      0      0      0     12      0      0      0      12     11  91% [T19R,T29A,E156G,F157-,R158-,T250I,G446V,L452R,T478K,D614G,P681R] 
..R.......I..........................N....L.......      12      0     11      1      0      0      0      0      12      7  58% [T19R,T95I,L452R,T478K,D614G,P681R,D950N,V1104L] 
F.R.......I..D.G--...................N..S.........      12      8      0      4      0      0      0      0      12      9  75% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R...F...I..DHG--...V...............N.....V......      12     12      0      0      0      0      0      0      12      9  75% [T19R,V36F,G75R,T95I,G142D,Y145H,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,G1124V] Delta+Y145H,A222V
..R..........D.G--...............T...N............      12      0      0     12      0      0      0      0      12      9  75% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812T,D950N] Delta
..R.......I....G--.V.................N....L.......      12      0      2     10      0      0      0      0      12      7  58% [T19R,T95I,E156G,F157-,R158-,G181V,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R.......I.GD.G--...................N............      12      9      1      2      0      0      0      0      12      9  75% [T19R,T95I,D138G,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.V.....I....G--...................N............      12      1      9      2      0      0      0      0      12     11  91% [T19R,A27V,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--.R.................NS...........      12      0      0     12      0      0      0      0      12      8  66% [T19R,G142D,E156G,F157-,R158-,G181R,L452R,T478K,D614G,P681R,D950N,A1020S] Delta
.....................V............................      12      1     11      0      0      0      0      0      12      6  50% [A222V,D614G] 
..R............G--..............L....N............      12      0      1     11      0      0      0      0      12      6  50% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P809L,D950N] Delta
F.R..........D.G--...................N...........L      12      6      0      2      4      0      0      0      12     11  91% [L5F,T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L
..R.......I..D.G--...............L...N..S.........      12     12      0      0      0      0      0      0      12     12 100% [T19R,T95I,G142D,E156G,F157-,R158-,A263V,L452R,T478K,D614G,P681R,P812L,D950N,A1078S] Delta
..R............G--...V...L...........N............      12      0      0      0     12      0      0      0      12     12 100% [T19R,E156G,F157-,R158-,A222V,V289L,L452R,T478K,D614G,P681R,D950N] 
.FR........L...G--...................N............      12      0      0     12      0      0      0      0      12     10  83% [L18F,T19R,S112L,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta+S112L
..R.......IP.D.G--...................N............      12      4      0      8      0      0      0      0      12     11  91% [T19R,T95I,S112P,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I..D.G--G..................N............      12     11      0      1      0      0      0      0      12     12 100% [T19R,T95I,G142D,E156G,F157-,R158-,E180G,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...V.......H.......N.N..........      12      0      0     12      0      0      0      0      12     11  91% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N,K1073N] Delta+T95_,A222V
..R........L.D.G--...................N.N..........      12      0      0     12      0      0      0      0      12     11  91% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073N] Delta+S112L
..R............G--.....L.............N..S.........      12      0     12      0      0      0      0      0      12     12 100% [T19R,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N,A1078S] Delta+T95_,P251L
..R............G--...V........K......N...Y........      12      0     12      0      0      0      0      0      12     12 100% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q675K,P681R,D950N,H1101Y] Delta+FurinRelated
..R...F...I..D.G--...................N..........Y.      11      1      8      0      0      0      0      2      11     10  90% [T19R,V36F,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,D1259Y] Delta
..R........L.D.G--................................      11      0      0     10      0      0      1      0      11      7  63% [T19R,S112L,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R] 
..R............G--...V...............N.........I..      11      0      1      1      9      0      0      0      11      6  54% [T19R,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,M1237I] Delta+T95_,A222V
..R......Y...D.G--.....L.............N............      11      2      8      1      0      0      0      0      11      9  81% [T19R,D80Y,G142D,E156G,F157-,R158-,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R..........D.G--.............R.....N............      11      2      0      8      0      1      0      0      11      7  63% [T19R,G142D,E156G,F157-,R158-,A243-,L244-,L452R,T478K,D614G,Q677R,P681R,D950N] Delta+FurinRelated
..R..........D.G--.E...L.............N............      11      3      8      0      0      0      0      0      11      7  63% [T19R,H49Y,G142D,E156G,F157-,R158-,G181E,P251L,L452R,T478K,D614G,P681R,D950N] Delta+T95_,P251L
..R............G--...V....V..........N............      11      0      3      0      8      0      0      0      11     10  90% [T19R,E156G,F157-,R158-,A222V,G446V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--.....L.....H.......N............      11      0      0     11      0      0      0      0      11     11 100% [T19R,G142D,E156G,F157-,R158-,P251L,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T95_,P251L
..R.......I....G--G..................N....L.......      11      0      0     11      0      0      0      0      11     11 100% [T19R,T95I,E156G,F157-,R158-,E180G,L452R,T478K,D614G,P681R,D950N,V1104L] Delta
..R..........D.G--.........A.........N............      11      1      5      3      2      0      0      0      11      8  72% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,E484A,D614G,P681R,D950N] 
..R..........D.G--....N..............N............      11      6      5      0      0      0      0      0      11      6  54% [T19R,G142D,E156G,F157-,R158-,T250N,L452R,T478K,D614G,P681R,D950N] 
..R.......I..-.G--...................N............      11      5      0      6      0      0      0      0      11      3  27% [T19R,T95I,L141-,G142-,V143-,Y144-,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R....V.......G--...V.........................I..      11      0     11      0      0      0      0      0      11     11 100% [T19R,A67V,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,Q1208H,M1237I] 
..R.......I..D.G--......L..Q.........N............      11      0     11      0      0      0      0      0      11      9  81% [T19R,T95I,G142D,E156G,F157-,R158-,W258L,L452R,T478K,E484Q,D614G,P681R,D950N] 
..R.......I....G--..Y..............L.N............      11      0     11      0      0      0      0      0      11     11 100% [T19R,T95I,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,I850L,D950N,V1129I] Delta
..R..........D.G--........V..........N..S.........      11      2      1      7      1      0      0      0      11     11 100% [T19R,G142D,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N,A1078S] Delta
..R.......I..D.V--...................N............      11     10      0      1      0      0      0      0      11      8  72% [T19R,T95I,G142D,E156V,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I....G--.V..........H......N............      11      0      0     11      0      0      0      0      11      8  72% [T19R,T95I,E156G,F157-,R158-,G181V,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
..R.......I..--G--...................N.T..........      11     11      0      0      0      0      0      0      11     11 100% [T19R,H66R,T95I,P139-,F140-,L141-,G142-,V143-,Y144-,Y145-,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073T] Delta
F.R..........D.G--...V.......H.......N............      11      0      0     11      0      0      0      0      11      8  72% [L5F,T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,Q613H,D614G,P681R,D950N] Delta+T95_,A222V
..R.......I..D.G--.............H.....N...........L      11     11      0      0      0      0      0      0      11     10  90% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N,V1264L,L1265F] Delta+FurinRelated
..S.......I..D.G--...................N............      11     10      0      1      0      0      0      0      11     11 100% [T19S,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R.......I.ND.G--...................N............      11     10      1      0      0      0      0      0      11     11 100% [T19R,T95I,D138N,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..A....I....G--....I..............N............      11      0     11      0      0      0      0      0      11      9  81% [T19R,T29A,T95I,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...V............V..N............      11      0     10      1      0      0      0      0      11     11 100% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,A845V,D950N] Delta+T95_,A222V
..R............G--...................N..T.........      11      0      0     11      0      0      0      0      11     10  90% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1078T] Delta
..R.......I.HD.G--......L............N............      11     11      0      0      0      0      0      0      11     11 100% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,W258L,L452R,T478K,D614G,P681R,T827I,D950N] 
..R.......I..D.G--.........Q.H.....L.N............      11      0     11      0      0      0      0      0      11      9  81% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484Q,Q613H,D614G,P681R,I850L,D950N] Delta+E484Q
..R.......I..D.G--......L............N.........I..      11      0      0     11      0      0      0      0      11     11 100% [T19R,T95I,G142D,E156G,F157-,R158-,W258L,K417N,L452R,T478K,D614G,P681R,D950N,M1237I] 
..R..A.T.....D.G--....I..............N............      11      1     10      0      0      0      0      0      11     11 100% [T19R,T29A,A67T,G142D,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R,D950N] Delta+T29A,T95_,T250I
..R.......I.HD.G--..Y................N............      11     11      0      0      0      0      0      0      11     11 100% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................N.......R....      10     10      0      0      0      0      0      0      10      9  90% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,P1162R] Delta
F.R.......I....G--................................      10      0      4      5      0      0      1      0      10      3  30% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,E1258D] 
..R.....I....D.G--...................NS...........      10      0      1      9      0      0      0      0      10      6  60% [T19R,V70I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,A1020S] 
..R.......I..D.G--...................N....A.......      10      1      0      0      0      0      0      9      10     10 100% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104A] Delta
..........I..D.......................N............      10      0     10      0      0      0      0      0      10      7  70% [T95I,G142D,L452R,T478K,D614G,P681R,D950N] 
..R............G--...................N.T..........      10      1      0      9      0      0      0      0      10      8  80% [T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,K1073T] Delta
..R.....I.I..D.G--...................N............      10      6      3      1      0      0      0      0      10      5  50% [T19R,V70I,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] 
..R............G--..HV...............N............      10      7      3      0      0      0      0      0      10      8  80% [T19R,E156G,F157-,R158-,D215H,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..R..A.........G--....I...........................      10      0      4      3      3      0      0      0      10      7  70% [T19R,T29A,E156G,F157-,R158-,T250I,L452R,T478K,D614G,P681R] 
..R.......I...HG--...V...............N..S.........      10      0     10      0      0      0      0      0      10      6  60% [T19R,T95I,Y145H,W152L,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N,A1078S] Delta+Y145H,A222V
..R.......I..D.G--.........G.........N............      10      6      1      3      0      0      0      0      10      5  50% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,E484G,D614G,P681R,D950N] 
..R.......I...HG--.................L.N............      10      0     10      0      0      0      0      0      10     10 100% [T19R,T95I,Y145H,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R.......I....G--.............H.....N.N..........      10      0      0     10      0      0      0      0      10      9  90% [T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N,K1073N] Delta+FurinRelated
..R.......I....G--...V............................      10      0      2      1      6      0      1      0      10      6  60% [T19R,T95I,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R] 
..R.......I..D.G--...........H.......N.N..........      10      2      8      0      0      0      0      0      10      8  80% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,Q613H,D614G,P681R,D950N,K1073N] 
..R.......I.HD.G--........V..........N............      10      8      0      2      0      0      0      0      10      9  90% [T19R,T95I,D138H,G142D,E156G,F157-,R158-,G446V,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...................N.........I.L      10     10      0      0      0      0      0      0      10     10 100% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237I,V1264L] Delta+V1264L
..R.......I..D.G--...................N....LV......      10      0      2      8      0      0      0      0      10      7  70% [T19R,T95I,K97E,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,V1104L,G1124V] Delta
..R......GI..D.G--...................N............      10      8      0      2      0      0      0      0      10      7  70% [T19R,D80G,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
F.R.......I..D.G--.............H.....N............      10      4      2      4      0      0      0      0      10      7  70% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
..R............G--.........Q......................      10      0      1      3      1      0      5      0      10      5  50% [T19R,E156G,F157-,R158-,L452R,T478K,E484Q,D614G,P681R] 
F.R.......I....G--...............S...N............      10      2      8      0      0      0      0      0      10     10 100% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,P812S,D950N] Delta
..I............G--................S...............      10      0     10      0      0      0      0      0      10      7  70% [T19I,E156G,F157-,R158-,L452R,T478K,D614G,P681R,A845S] 
..R..........D.G--...V....V..........N...........L      10      0      0     10      0      0      0      0      10      7  70% [T19R,G142D,E156G,F157-,R158-,A222V,G446V,L452R,T478K,D614G,P681R,D950N,N1074S,V1264L] Delta+N1074S,V1264L
..R..........D.G--.....L...V.........N............      10      0      9      0      1      0      0      0      10      5  50% [T19R,G142D,E156G,F157-,R158-,P251L,A262S,T307I,L452R,T478K,E484V,D614G,P681R,D950N] 
I.R............G--...................N............      10      0      0     10      0      0      0      0      10      7  70% [L5I,T19R,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R.......I..D.G--...................SV...........      10     10      0      0      0      0      0      0      10     10 100% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950S,A1020V,E1072A] 
..R..........D.G--...................N.........T..      10      0      3      7      0      0      0      0      10      8  80% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N,M1237T] Delta
F.R.......I..D.G--......L............N............      10      0     10      0      0      0      0      0      10     10 100% [L5F,T19R,T95I,G142D,E156G,F157-,R158-,W258L,L452R,T478K,D614G,P681R,D950N] 
..R..........D.G--...V........K......N...Y........      10      0     10      0      0      0      0      0      10      9  90% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q675K,P681R,D950N,H1101Y] Delta+FurinRelated
..R..........D.G--...V........H......N............      10     10      0      0      0      0      0      0      10     10 100% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,Q675H,P681R,D950N] Delta+FurinRelated
.FR......Y...D.G--...................N............      10      0      1      9      0      0      0      0      10      9  90% [L18F,T19R,D80Y,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
..R..........D.G--...V..........S....N............      10      0      7      3      0      0      0      0      10      5  50% [T19R,G142D,E156G,F157-,R158-,A222V,D253A,L452R,T478K,D614G,P681R,P809S,D950N,D979E] Delta+T95_,A222V
..R..........D.G--...V......I........N............      10      0      1      8      1      0      0      0      10      7  70% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,T572I,D614G,P681R,D950N] Delta+T95_,A222V
..R..........D.G--...................N.....S......      10      9      0      0      1      0      0      0      10      8  80% [T19R,G142D,E156G,F157-,R158-,Q239E,L452R,T478K,D614G,P681R,D950N,G1124S] Delta
..R.........YD.G--.V.........H.......N............      10      0     10      0      0      0      0      0      10      8  80% [T19R,D138Y,G142D,E156G,F157-,R158-,G181V,L452R,T478K,Q613H,D614G,P681R,D950N] 
..R..........D.G--...V...I...........N........C...      10      0      0     10      0      0      0      0      10      9  90% [T19R,G142D,E156G,F157-,R158-,A222V,V289I,L452R,T478K,D614G,P681R,D950N,G1219C] Delta+T95_,A222V,V289I
F.R.......I....G--.............H.....N............      10      0     10      0      0      0      0      0      10      5  50% [L5F,T19R,T95I,E156G,F157-,R158-,L452R,T478K,D614G,Q677H,P681R,D950N] Delta+FurinRelated
-.R.......I..D.G--.................L.N............      10      0     10      0      0      0      0      0      10      5  50% [L5-,T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,I850L,D950N] Delta
..R.......I..D.G--..G................N.....V......      10     10      0      0      0      0      0      0      10     10 100% [T19R,T95I,G142D,E156G,F157-,R158-,D215G,L452R,T478K,D614G,P681R,D950N,G1124V] Delta
..R..........D.G--...........E.......N............      10     10      0      0      0      0      0      0      10     10 100% [T19R,G142D,E156G,F157-,R158-,L452R,T478K,D574Y,Q613E,D614G,P681R,S813I,D950N,G1167V] 
..R..........D.G--..Y................N...........L      10      0      0      0     10      0      0      0      10     10 100% [T19R,G142D,E156G,F157-,R158-,D215Y,L452R,T478K,D614G,P681R,D950N,V1264L] Delta+V1264L

Download

 

last modified: Thu Oct 14 13:00 2021



GISAID data provided on this website is subject to GISAID's Terms and Conditions
Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health