COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


XSpike

eXplore the Spike protein sequence in the SARS CoV-2 virus

Last update: May 19, 2022

Dates of current data
 

Delta and Omicron Variants
Global
Early 2021 Variants color key
Delta Variants color key
Delta Omicron Variants color key

Download

Evaluating 490336 sequences of length 3136
Sampled from 2022-03-20 to 2022-05-16.
Specified Date Range: ['2022-03-20', '2022-05-19']
Highest entropy sites for: Global
  Site Entropy
    27  0.2959
    24  0.2952
    26  0.2944
    25  0.2870
   408  0.2501
   452  0.2499
   371  0.2493
   212  0.2472
    70  0.2448
    69  0.2417
    19  0.2317
   213  0.2287
   376  0.2279
   405  0.2256
   547  0.2238
   496  0.2235
   211  0.2231
    95  0.2224
   446  0.2223
   981  0.2214
    67  0.2211
   144  0.2210
   856  0.2206
   145  0.2194
   143  0.2188
   214  0.0065
   704  0.2071
   346  0.2058
   440  0.1120
   417  0.0726
     5  0.0709
    68  0.0476
   493  0.0324
  1162  0.0313
   681  0.0297
   248  0.0273
   486  0.0269
    64  0.0245
   255  0.0229
   157  0.0220
   879  0.0184
  1221  0.0181
   798  0.0168
  1259  0.0165
   701  0.0164


Most highly correlated site-pairs for: Global
               cramerV  mutInfo
    27     24   0.7566   0.2909
    27     26   0.5835   0.2902
    24     26   0.8778   0.2895
    27     25   0.4991   0.2841
    26     25   0.4990   0.2828
    24     25   0.5762   0.2826
    70     69   0.5773   0.2373
   371    376   0.5701   0.2200
   212    211   0.4084   0.2192
   371    405   0.6968   0.2172
   981    856   0.7059   0.2171
   145    143   0.7067   0.2164
    95    856   0.7041   0.2160
    95     67   0.4981   0.2160
   371    856   0.7022   0.2158


   408    405   0.9342   0.2009
   408    376   0.9269   0.1968
    70    144   0.9244   0.1866
   408    371   0.9239   0.1980
   408     95   0.9206   0.1934
   408    213   0.9202   0.1928
   408    856   0.9201   0.1929
   408    981   0.9198   0.1926
   408     67   0.9193   0.1922
   408    143   0.9187   0.1906
   408    145   0.9181   0.1904
   408    547   0.9167   0.1909
   408     19   0.9138   0.1900
   408    144   0.9115   0.1867
   408    496   0.9115   0.1881


Most common patterns for local area, where Local = Global
                                          111
            111122222233344444444456777889122
 12222666679444511114547700144589948009578625
594567478905345712348561658706263671148691219
LTLPPAWAIHVTVYYFNLVRYSRSTDRKNGLFQGTPASGNALPID  Global     UK  Eu-UK  NAmer   Asia Africa  SAmer  Ocean   Local  Exact  Pct [Context]
                                               490336 149596 174627 128966  20298   1795   2173  12882  444416 <----------- Totals
.I---S............G....FANSNK...R..H.........  332986 120218 107982  79194  13769    537    518  10769  332986 275986  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK.Q.R..H.L.......   21321    191    206  20756    134      0      5     29   21321  18972  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.......V.--I---.-I....KL...NKS..RSKH...K.F...   20172   3272   3287  12021    966      3    366    257   20172  15108  74% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I................G....FANSNK...R..H.........   10177      0  10142      1     31      0      0      3   10177   8331  81% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I---S............G....FANSN....R..H.........    8910      0   6611    967   1008      2    322      0    8910   6523  73% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
FI---S............G....FANSNK...R..H.........    4683   1405   1577   1422    129      5     10    135    4683   3909  83% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S..T.........G....FANSNK...R..H.........    3015   1033   1501    252     84      4      0    141    3015   2498  82% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I.....L...NKS..RSKH...K.F...    2817    463    585   1169     57      2     98    443    2817   1745  61% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G....FANSTK...R..H.........    2518   1648    246    449    156      1      0     18    2518   2229  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
.I---S............G....FAN.NK...R..H.........    2384     11   1390    500    406      7     69      1    2384   1902  79% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK...R..H.L.......    2374    489    398   1268     15      0     22    182    2374   1949  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S...--.......G....FANSNK.RV...H.........    1681    204    443    195     26    789      1     23    1681    718  42% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I---S............G....FANSNK...R............    1514      0   1493     11      0      0      0     10    1514   1025  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK.M.R..H.........    1474    302    890    223     33      0     18      8    1474   1011  68% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
.I---S...........SG....FANSNK...R..H.........    1431    572    620    175     34     30      0      0    1431   1176  82% [T19I,L24-,P25-,P26-,A27S,G142D,L212S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S...--.......G....FANSNK...R..H.........    1292    545    398    298     34      7      0     10    1292   1129  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G..F.FANSNK...R..H.........    1281    250    322    662     30      1      1     15    1281   1146  89% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK...R..H.......T.    1094    197     57     44    631      0      0    165    1094    943  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,I1221T] Omicron_BA.2
.I---S............G....FANSNK...R..H......L..    1006    697     99    186     13      0      0     11    1006    865  85% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2
.I---S............G....FANSNK...R..H..D......     932    192    104    200    329      1      0    106     932    770  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,G798D,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK...R..H........H     766      1    736     29      0      0      0      0     766    675  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1259H] Omicron_BA.2
.I---S.........L..G....FANSNK...R..H.........     751    371    216    125     33      0      0      6     751    604  80% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK.Q.R..H.L..V....     684      1      5    674      2      0      0      2     684    618  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,A879V,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.I---S............G.S..FANSNK...R..H.........     659    146     98    409      6      0      0      0     659    427  64% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.H..FANSNK...R..H.........     630    180    369     78      2      0      0      1     630    315  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,S1261Y] Omicron_BA.2
.I---S............G....FANSNK...R..H......S..     629    152    300    158     11      8      0      0     629    547  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.2
.I---SR...........G....FANSNK...R..H.........     573    102    347     51     65      1      0      7     573    490  85% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.....ANSNK...R..H.........     571    108    434     13      6      1      9      0     571    450  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....KL....KS..RSKH...K.F...     556      0    479     10     56      0     11      0     556    262  47% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.......V.--I---.-I.....L...NKS..RSKHV..K.F...     554    299    144     89      7      0     11      4     554    161  29% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G....FANSNK.R.R..H.........     549     37    448     47     11      0      0      6     549    494  89% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---SL...........G....FANSNK...R..H.........     545     59    392     57     13     24      0      0     545    473  86% [T19I,L24-,P25-,P26-,A27S,W64L,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S..........-IG....FANSNK...R..H.........     403     50    317     30      3      0      0      3     403    330  81% [T19I,L24-,P25-,P26-,A27S,G142D,N211-,L212I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNKS..RS.H.........     390      0    375     15      0      0      0      0     390    383  98% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..---S............G....FANSNK...R..H.........     377      0    118      6    248      0      0      5     377    272  72% [L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G...TFANSNK...R..H.........     362    124    196     20     19      0      0      3     362    284  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK...R..H....V....     350     59     67    210      8      0      2      4     350    301  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,A879V,Q954H,N969K] Omicron_BA.2
F......V.--I---.-I....KL...NKS..RSKH...K.F...     329     33     43    236     13      0      3      1     329    261  79% [L5F,A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.IF-I-............G....FANSNK...R..H.........     291      0    291      0      0      0      0      0     291    221  75% [T19I,L24F,P25-,P26I,A27-,Y28X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSN..Q.R..H.L.......     238      0      3    215      7      0     13      0     238    198  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.I---S.......-....G....FANSNK...R..H.........     236    113     60     47     11      2      0      3     236    148  62% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK...R..HV........     234    117     70     38      0      0      0      9     234    215  91% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............E....FANSNK...R..H.........     225     75     32    111      3      0      0      4     225    198  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S.................FANSNK...R..H.........     201      0     29      6    162      2      0      2     201     79  39% [T19I,L24-,P25-,P26-,A27S,G142D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,F565S,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....YANSNK...R..H.........     199     19    135      8     35      0      0      2     199    136  68% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371Y,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S.........S..G....FANSNK...R..H.........     199     67    105     12     13      0      0      2     199    160  80% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.........K...R..H.........     169      0    166      2      0      1      0      0     169    109  64% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............GH...FANSNK...R..H.........     168     83     73      6      4      0      0      2     168    137  81% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,R214H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.N..FANSNK...R..H.........     166     22     80     58      3      0      1      2     166    112  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,+247SGE,Y248N,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S....A.......G....FANSNK...R..H.........     159    128     23      4      2      2      0      0     159    142  89% [T19I,L24-,P25-,P26-,A27S,V70A,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
FI---S............G....FANSNK.Q.R..H.L.......     146      8      0    137      1      0      0      0     146    132  90% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.I---S............G....FANSNK......H.........     140      8     33     68     29      1      0      1     140     52  37% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK...R.KH.........     137     33     58     36      7      0      0      3     137     97  70% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANS.K...R..H.........     135      0     78     37     18      0      1      1     135     91  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....KL...TKS..RSKH...K.F...     125      5     12    106      1      0      1      0     125     95  76% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417T,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
FI................G....FANSNK...R..H.........     122      0    120      0      2      0      0      0     122    106  86% [L5F,T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.......V.--I---.-I....KL........RSKH...K.F...     122      0      1    121      0      0      0      0     122     56  45% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G.............R..H.........     118      0      3    115      0      0      0      0     118     43  36% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.I....L...........G....FANSNK...R..H.........     111      0    111      0      0      0      0      0     111    101  90% [T19I,W64L,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
FI---S............G....FANSN....R..H.........     111      0     85     13     12      0      1      0     111     75  67% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.L---S............G....FANSNK...R..H.........     107     38     39     24      1      0      0      5     107     92  85% [T19L,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK.Q.R..H.........     107      3     26     75      3      0      0      0     107     68  63% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.L---S............G....FANSNK...R..H..D......     105      0      0    105      0      0      0      0     105     98  93% [T19L,L24-,P25-,P26-,A27S,G142D,V159I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,G798D,Q954H,N969K] 
.I---S............G....FAN.NK.Q.R..H.L.......     102      0      5     80     14      0      3      0     102     78  76% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....KL...N.S..RSKH...K.F...      90      0     12     26      1      0     51      0      90     47  52% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I...............SG....FANSNK...R..H.........      87      0     87      0      0      0      0      0      87     82  94% [T19I,G142D,L212S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.......V.--I---.-I....KL...NK...RSKH...K.F...      87      1     13     42      3      0      4     24      87     50  57% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.......V.--I---.......KL...NKS..RSKH...K.F...      83      0     59     16      8      0      0      0      83     45  54% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G....FAN......R..H.........      80      0      3     77      0      0      0      0      80     57  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....KL...NKS..RSKH.L.K.F...      77     17      4     56      0      0      0      0      77     70  90% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G....FA.......R..H.........      75      0      0     75      0      0      0      0      75     33  44% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S....I.......G....FANSNK...R..H.........      74      1      1     71      1      0      0      0      74     70  94% [T19I,L24-,P25-,P26-,A27S,V70I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S..T.........G....FANSN....R..H.........      72      0     59      5      8      0      0      0      72     52  72% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..---S............G....YANSNK...R..H.........      71      0      1      0     70      0      0      0      71     65  91% [L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371Y,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,E1202Q] 
.I---S............G......NSNK...R..H.........      68      1     58      3      2      4      0      0      68     28  41% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK...R.IH.........      66     21     19     20      1      0      1      4      66     52  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S..V.......G.G....FANSNK...R..H.........      64      4     17      7     36      0      0      0      64     56  87% [T19I,L24-,P25-,P26-,A27S,I68V,G142D,N211G,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S...........SG....FANSN....R..H.........      62      0     51      5      5      0      1      0      62     39  62% [T19I,L24-,P25-,P26-,A27S,G142D,L212S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I.....L....KS..RSKH...K.F...      62      0     57      0      2      0      3      0      62     24  38% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G....FANSNK...R..H....S....      60     32     20      8      0      0      0      0      60     55  91% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,A879S,Q954H,N969K] Omicron_BA.2
.I..............-IG....FANSNK...R..H.........      59      0     59      0      0      0      0      0      59     52  88% [T19I,G142D,N211-,L212I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I................G.H..FANSNK...R..H.........      58      0     58      0      0      0      0      0      58     42  72% [T19I,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,S1261Y] Omicron_BA.2+P25_,P26_
.I---S.......-....G....FANSNK.Q.R..H.L.......      58      0      1     57      0      0      0      0      58     35  60% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.I---S............G....FANSN....R..H.L.......      57      0     22     34      1      0      0      0      57     47  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I...-............G....FANSNK...R..H.........      57      0     57      0      0      0      0      0      57     39  68% [T19I,A27-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I---S...Y........G....FANSNK...R..H.........      55     27     20      7      0      0      0      1      55     38  69% [T19I,L24-,P25-,P26-,A27S,H69Y,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I................G....FANSNK.M.R..H.........      54      0     54      0      0      0      0      0      54     49  90% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
F......V.--I---.-I.....L...NKS..RSKH...K.F...      52     12     11     21      0      0      2      6      52     35  67% [L5F,A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I......T.........G....FANSNK...R..H.........      51      0     51      0      0      0      0      0      51     37  72% [T19I,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.......V.--I---.--....KL...NKS..RSKH...K.F...      50      5      1     44      0      0      0      0      50     22  44% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212-,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S...--.......G....FANSN....R..H.........      49      0     35      0      6      0      8      0      49     35  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK.R.R..H........H      48      0     48      0      0      0      0      0      48     45  93% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1259H] 
.......V.--I---.-I....KL...NKS..RSK....K.F...      46      0     46      0      0      0      0      0      46     28  60% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,N764K,D796Y,N856K,Q954H,N969K,L981F] 
.I---S............G....FA.SNK...R..H.........      46      1     31      5      1      0      0      8      46     36  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I..--............G....FANSNK...R..H.........      45      0     45      0      0      0      0      0      45     30  66% [T19I,P26-,A27-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSIK...R..H.........      44     13     22      6      1      2      0      0      44     33  75% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417I,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I.......--.......G....FANSNK...R..H.........      42      0     42      0      0      0      0      0      42     37  88% [T19I,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I---S............G....FANSNK...R..H......R..      42     14     21      6      0      0      0      1      42     39  92% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162R] Omicron_BA.2
.I................G..F.FANSNK...R..H.........      41      0     41      0      0      0      0      0      41     37  90% [T19I,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I---S............G....FANSNK...R..H........Y      41     20     14      6      0      0      0      1      41     35  85% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1259Y] Omicron_BA.2
.I---S............G....FAN..K...R..H.........      41      0     11     23      7      0      0      0      41     34  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G......N.NK...R..H.........      41      0     40      1      0      0      0      0      41     24  58% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G.....AN.NK...R..H.........      40      0     35      5      0      0      0      0      40     26  65% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI---S..T.........G....FANSNK...R..H.........      40     21      9      0      1      0      0      9      40     27  67% [L5F,T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANST....R..H.........      39      0      9      7     22      0      1      0      39     31  79% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....F.NSNK...R..H.........      37      5     10     21      1      0      0      0      37     15  40% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....TL...NKS..RSKH...K.F...      37      6      2     11      0      0      2     16      37     24  64% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346T,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
.......V.--I---.-I....KL...NKS..RSKH...K.FL..      37      5      5     19      8      0      0      0      37     25  67% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F,P1162L] Omicron_BA.1.1
.I---S..M.........G....FANSNK...R..H.........      36     24      9      3      0      0      0      0      36     32  88% [T19I,L24-,P25-,P26-,A27S,I68M,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSN.......H.........      36      0     30      4      2      0      0      0      36     11  30% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S.S..........G....FANSNK...R..H.........      35     18      9      0      2      0      0      6      35     31  88% [T19I,L24-,P25-,P26-,A27S,A67S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.R.............-..............R....R.........      35      0      8     13      9      2      0      3      35      5  14% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
.I---S............G....FANSNK...R..Y.........      33     21     10      2      0      0      0      0      33     30  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681Y,N764K,D796Y,Q954H,N969K] 
FI---S............G....FANSNK...R..H.L.......      33      4     13     13      3      0      0      0      33     27  81% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
....L..V.--I---.-I....KL...NKS..RSKH...K.F...      32     16      1     14      0      0      1      0      32     30  93% [P26L,A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G....FANSNK...R..H.....I...      32     12     15      2      3      0      0      0      32     22  68% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,L981I] Omicron_BA.2
.I---S............G....F...NK...R..H.........      32      0      3     29      0      0      0      0      32     17  53% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI---S...--.......G....FANSNK.RV...H.........      31      0     18      2      0     11      0      0      31     23  74% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.......V.--I---.-I....KL...NKS..RSKH...K.FS..      30      5      4     20      1      0      0      0      30     28  93% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F,P1162S] Omicron_BA.1.1
.I---S.......-...FG....FANSNK...R..H.........      30      1      0     29      0      0      0      0      30     29  96% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,L212F,+212MAEL,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I.............L..G....FANSNK...R..H.........      30      0     30      0      0      0      0      0      30     14  46% [T19I,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I---S..R.........G....FANSNK...R..H.........      30      2     26      1      1      0      0      0      30     30 100% [T19I,L24-,P25-,P26-,A27S,I68R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I...FKL...NKS..RSKH...K.F...      29      5      0     23      1      0      0      0      29     28  96% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,S255F,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............GL...FANSNK...R..H.........      29      5     20      0      1      0      0      3      29     25  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,R214L,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..---S............G....FANSTK...R..H.........      29      0      0      0     29      0      0      0      29     27  93% [L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S..V.........G....FANSNK...R..H.........      28      0     24      3      0      0      0      1      28     16  57% [T19I,L24-,P25-,P26-,A27S,I68V,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,R1014T] Omicron_BA.2
.......V.--I---L-I....KL...NKS..RSKH...K.F...      28      2      3     20      3      0      0      0      28     20  71% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,F157L,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G...TFANSN....R..H.........      28      0     26      0      1      0      1      0      28     22  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G...KFANSNK...R..H.........      27      2     18      5      1      0      0      1      27     23  85% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I................G....FANSNK...R..H......S..      27      0     27      0      0      0      0      0      27     26  96% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.2+P25_,P26_
.......V.--I---S-I....KL...NKS..RSKH...K.F...      27      1     19      6      1      0      0      0      27     17  62% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,F157S,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G....FANSN..M.R..H.........      27      0     21      5      1      0      0      0      27     14  51% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
.I---S...--.......G....FANSN..RV...H.........      27      0     24      0      3      0      0      0      27     18  66% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S.....S......G....FANSNK...R..H.........      26     19      6      0      0      0      0      1      26     25  96% [T19I,L24-,P25-,P26-,A27S,T95S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I.....F.N.TKS..R..H.........      26      6     16      3      0      0      0      1      26     25  96% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,G339D,S371F,S373P,S375F,D405N,K417T,N440K,G446S,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G..F.FANSNK.M.R..H.........      25      0     24      1      0      0      0      0      25     23  92% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,D936Y,Q954H,N969K] Omicron_BA.2+L452M
.......V.--I---.-I.....L...TKS..RSKH...K.F...      25      0      5     15      0      0      3      2      25      9  36% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417T,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.......V.--I---.-I....KF...NKS..RSKH...K.F...      24      1      8     13      2      0      0      0      24     14  58% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371F,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
.L---S............G....FAN.NK...R..H..D......      24      0      0     24      0      0      0      0      24     23  95% [T19L,L24-,P25-,P26-,A27S,G142D,V159I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,G798D,Q954H,N969K] 
.......V.--I---.-I.....L...N.S..RSKH...K.F...      23      0      5      3      1      0     14      0      23     15  65% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G...KL.NSNK...R..H.........      23      3      4     15      1      0      0      0      23     23 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346K,S371L,S373P,S375F,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G.....A.......R..H.........      23      0      0     23      0      0      0      0      23     13  56% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.I................G....FANSNK.R.R..H.........      22      0     22      0      0      0      0      0      22     22 100% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I.....L...NK...RSKH...K.F...      22      1      4     12      0      0      2      3      22      7  31% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G..P.FANSNK...R..H.........      22      1      3      5      9      0      0      4      22     16  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255P,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FAN......R..H.L.......      22      0      0     22      0      0      0      0      22     18  81% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....KL...NKSM.RSKH...K.F...      21      2      1     14      3      0      0      1      21     13  61% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,L452M,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............GS...FANSNK...R..H.........      21      1      3     16      1      0      0      0      21     21 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,R214S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
FI---S...........SG....FANSNK...R..H.........      21      5      0     15      0      1      0      0      21     19  90% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,L212S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S..K.........G....FANSNK...R..H.........      20     12      7      0      0      0      0      1      20     15  75% [T19I,L24-,P25-,P26-,A27S,I68K,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.D..FANSNK...R..H.........      20      1     12      2      5      0      0      0      20      9  45% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,+247SVL,Y248D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
FI---S............G....FAN.NK...R..H.........      20      0     11      6      3      0      0      0      20     17  85% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FA.......R..H.L.......      20      0      0     20      0      0      0      0      20     14  70% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
FI---S............G..F.FANSNK...R..H.........      20      5      4     11      0      0      0      0      20     15  75% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I....KL...NKS...SKH...K.F...      19      8      2      8      1      0      0      0      19      8  42% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
.I---S....F.......G....FANSNK...R..H.........      19      7     11      1      0      0      0      0      19     15  78% [T19I,L24-,P25-,P26-,A27S,V70F,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK...R..H.......V.      19     13      2      4      0      0      0      0      19     15  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,I1221V] Omicron_BA.2
.I---S.....I......G....FANSNK...R..H.........      19      5      9      4      0      0      0      1      19     15  78% [T19I,L24-,P25-,P26-,A27S,T95I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I.....L........RSKH...K.F...      19      0      0     19      0      0      0      0      19      6  31% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,D796Y,N856K,Q954H,N969K,L981F] 
.I---S............G.....ANS.K...R..H.........      19      0      9      0     10      0      0      0      19      6  31% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764X,D796Y,Q954H,N969K] 
.I---SR...........G....FANSN....R..H.........      19      0     15      2      2      0      0      0      19     11  57% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK...R..R.........      18      0     13      4      1      0      0      0      18     17  94% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681R,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNKD..R..H.........      18     13      4      1      0      0      0      0      18     14  77% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNKS..R..H.........      18      2      8      4      1      0      1      2      18     13  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S.........L..G....FANSN....R..H.........      18      0     13      0      5      0      0      0      18     11  61% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FANSNK.Q....H.L.......      18      0      0     18      0      0      0      0      18      9  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.I---S............G....L.NSNK...R..H.........      18      1      4     13      0      0      0      0      18     18 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371L,S373P,S375F,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK...R..HS........      17      0     17      0      0      0      0      0      17      8  47% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701S,N764K,D796Y,L849I,Q954H,N969K] Omicron_BA.2
..................G....FANSNK...R..H.........      17      0     14      2      1      0      0      0      17     13  76% [G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FA..NK...R..H.........      17      0      0     10      1      6      0      0      17     15  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I..H.KL...NKS..RSKH...K.F...      16     11      0      5      0      0      0      0      16     10  62% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,Y248H,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S............G....FAN.N....R..H.........      16      0      5     10      1      0      0      0      16     14  87% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G..F.FANSN....R..H.........      16      0     11      3      2      0      0      0      16     10  62% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FAN.NK...R..H....V....      16      0      0     16      0      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,A879V,Q954H,N969K] 
.R.........I...-.............RR....R.........      16      0      0      0      0      0      0     16      16      8  50% [T19R,T95I,G142D,E156G,F157-,R158-,G446R,L452R,T478K,Q613H,D614G,P681R,D950N,L1063F] 
.I---S............G....F.NSN....R..H.........      16      0     15      1      0      0      0      0      16      9  56% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---SC...........G....FANSNK...R..H.........      15      2      3      8      2      0      0      0      15     12  80% [T19I,L24-,P25-,P26-,A27S,W64C,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FAN.NK...R..H.L.......      15      0      8      7      0      0      0      0      15      9  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.I....R...........G....FANSNK...R..H.........      15      0     15      0      0      0      0      0      15     15 100% [T19I,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
.R.........I...-..............R....R.........      15      3      7      4      1      0      0      0      15     10  66% [T19R,T95I,G142D,E156G,F157-,R158-,L452R,T478K,D614G,P681R,D950N] Delta
.......V.--I--..-I....KL...NKS..RSKH...K.F...      15      3      5      7      0      0      0      0      15      8  53% [A67V,H69-,V70-,T95I,G142-,V143-,Y144-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.......V.--I---.-I.....F...NKS..RSKH...K.F...      15      1      4      4      1      0      2      3      15      7  46% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371F,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.........--I---.-I....KL...NKS..RSKH...K.F...      15      0     15      0      0      0      0      0      15     10  66% [H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
.I---S...Y........G....FANSNK.Q.R..H.L.......      15      0      0     15      0      0      0      0      15     10  66% [T19I,L24-,P25-,P26-,A27S,H69Y,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.I---S............G....FANSN....R..H..D......      15      0     10      1      3      0      1      0      15      8  53% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,G798D,Q954H,N969K] Omicron_BA.2
.I---S.........S..G....FANSN....R..H.........      15      0     10      0      5      0      0      0      15      8  53% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I.....L....KS..RSKHV..K.F...      15      0     15      0      0      0      0      0      15      5  33% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,F643L,H655Y,N679K,P681H,A701V,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S..T.........G....FANSNK...R............      15      0     14      0      1      0      0      0      15      9  60% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
FI---S............G....FANSNK...R............      15      0     14      1      0      0      0      0      15      5  33% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
.I---S............G......NSN....R..H.........      15      0     15      0      0      0      0      0      15      8  53% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S.........L..G....FANSNK.Q.R..H.L.......      15      0      0     15      0      0      0      0      15     15 100% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.......V.--I---.-I.....L...NKS...SKH...K.F...      14      0      4      6      1      2      1      0      14      3  21% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,N460K,S477N,T478K,E484A,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
.......V.--I---.-I....KL...NKS..RSKH...K.F..H      14      0      8      6      0      0      0      0      14     12  85% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F,D1259H] Omicron_BA.1.1
.I---S...--.......G....FAN.NK.RV...H.........      14      0      3      1      3      7      0      0      14      5  35% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNKS..RSKH.........      14      0     14      0      0      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G........NK...R..H.........      14      0     13      0      0      1      0      0      14      8  57% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V-T-I---.-I....KL...NKS..RSKH...K.F...      14     12      0      2      0      0      0      0      14     12  85% [A67V,I68-,H69T,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] 
FI---S...--.......G....FANSNK...R..H.........      14      4      8      0      0      0      0      2      14     14 100% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FAN.TK...R..H.........      14      0     13      1      0      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S..........D.G....FANSNK...R..H.........      13      9      4      0      0      0      0      0      13     10  76% [T19I,L24-,P25-,P26-,A27S,G142D,N211D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S.....A......G....FANSNK...R..H.........      13      1      8      4      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,T95A,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S........H...G....FANSNK...R..H.........      13      5      2      5      0      0      0      1      13      8  61% [T19I,L24-,P25-,P26-,A27S,G142D,Y145H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....FAN.NK...R............      13      0     13      0      0      0      0      0      13      6  46% [T19I,L24-,P25-,P26-,A27S,V47X,L48X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
.I---S............G...KL...NK...R..H.........      13      0      3      6      4      0      0      0      13      9  69% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346K,S371L,S373P,S375F,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....L...NK...R..H.........      13      0      8      2      2      0      1      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371L,S373P,S375F,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSN....R..H......L..      13      0      8      4      1      0      0      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2
.I................G....FANSNK...R..H....V....      13      0     13      0      0      0      0      0      13     10  76% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,A879V,A890V,Q954H,N969K] Omicron_BA.2+P25_,P26_
.I---S..T.........G....FANSNK...R..H........H      13      0     13      0      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1259H] Omicron_BA.2
FI---S............G....FANSTK...R..H.........      12     11      0      1      0      0      0      0      12     10  83% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
.I---S............G...KL..SNK...R..H.........      12      1      3      6      2      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346K,S371L,S373P,S375F,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.............................................      12      0      9      2      0      0      1      0      12      4  33% [+214RRAT,H245X,D614G,Q675-,T676-,Q677-,T678S,N679-,S680-,R682X,R683X] 
.I.---............G....FANSNK...R..H.........      12      5      5      0      1      1      0      0      12     10  83% [T19I,P25-,P26-,A27-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.H..FANSN....R..H.........      12      0     10      1      0      0      1      0      12      4  33% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,S1261Y] Omicron_BA.2
FI---S............G.....ANSNK...R..H.........      11      3      8      0      0      0      0      0      11      7  63% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---........L...NKS..RSKH...K.F...      11      0      8      2      0      0      0      1      11      6  54% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S..-.........G....FANSNK...R..H.........      11     11      0      0      0      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,I68-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I....KL...NKS..RSKH...K.....      11      0      8      2      1      0      0      0      11      6  54% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K] 
.......V.--I---S-I....KL...NK.M.RSKH...K.F...      11      0      0     11      0      0      0      0      11      6  54% [A67V,H69-,V70-,G72E,T95I,G142D,V143-,Y144-,Y145-,F157S,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I.....V.--I---.-I....KL...NKS..RSKH...K.F...      11      1      0     10      0      0      0      0      11     10  90% [T19I,A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.......V.--I---.-I....KLA..NKS..RSKH...K.F...      11      1      0      9      1      0      0      0      11      5  45% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,T376A,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.......V.--I---.-I.....L...TKS..RSKHV..K.F...      11      1      0     10      0      0      0      0      11      7  63% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,M177I,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417T,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G....FANSNK...R..H...S.....      11      3      4      3      0      0      0      1      11      8  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,N856S,Q954H,N969K] Omicron_BA.2
.......V.--I---.--.....L...NKS..RSKH...K.F...      11      0      0      8      0      0      1      2      11      5  45% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212-,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
.I---S............G....FSNSNK...R..H.........      11      2      4      1      0      4      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376S,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S...--.......G....FAN.NK...R..H.........      11      0      4      3      3      0      1      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANS.....R..H.........      11      0      4      6      1      0      0      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSNK...R..H......Q..      11      1      7      0      1      0      0      2      11     10  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162Q] Omicron_BA.2
.I---S............G....FANSNK...RS.H.........      11      1      3      5      2      0      0      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S..T.........G....FAN.NK...R..H.........      11      0      5      2      3      0      1      0      11      6  54% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G.S..FANSN....R..H.........      11      0      6      4      1      0      0      0      11      5  45% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S...........SG....FANSNK...R............      11      0     11      0      0      0      0      0      11      7  63% [T19I,L24-,P25-,P26-,A27S,G142D,L212S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
.I................G....F.NSNK...R..H.........      11      0      0      0     11      0      0      0      11      7  63% [T19I,G142X,V213G,G339D,S371F,D405N,R408S,K417N,N440K,E484A,Q493R,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---SR...........G....FANSNK...R..H........H      11      0     11      0      0      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1259H] Omicron_BA.2
.I---S............G....FANSNK...R..H.......M.      10      1      2      6      1      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,I1221M] Omicron_BA.2
.I---S..........S.G....FANSNK...R..H.........      10      3      6      1      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,G142D,N211S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I.....L...NKS..RSKH...K.FL..      10      3      4      1      0      0      2      0      10      5  50% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F,P1162L] Omicron_BA.1
.IS-H-............G....FANSNK...R..H.........      10      3      0      3      4      0      0      0      10      9  90% [T19I,L24S,P25-,P26H,A27-,Y28-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......V.--I---.-I....KL...NKS..RSKHV..K.F...      10      8      1      1      0      0      0      0      10      7  70% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
FI---S............G....FANSNK...R..H......L..      10      6      2      2      0      0      0      0      10      6  60% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2
-I---S............G....FANSNK...R..H.........      10      0     10      0      0      0      0      0      10     10 100% [L5-,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.......V.--I---.-I....KL...N....RSKH...K.F...      10      0      6      4      0      0      0      0      10      4  40% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
.I---S....G.......G....FANSNK...R..H.........      10      5      3      0      2      0      0      0      10      3  30% [V3G,T19I,L24-,P25-,P26-,A27S,V70G,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G.....A..NK...R..H.........      10      0      7      3      0      0      0      0      10      3  30% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---SC...........G....FANSNK.M.R..H.........      10      0      0     10      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,W64C,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
.I.-..............G....FANSNK...R..H.........      10      0     10      0      0      0      0      0      10      6  60% [T19I,P25-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I---S............G....FANSN....R..H......S..      10      0      3      3      1      0      3      0      10      4  40% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.2
.I---S..R.........G....FANSN....R..H.........      10      0      9      0      0      0      1      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,I68R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I---S............G....F...NK.Q.R..H.L.......      10      0      0     10      0      0      0      0      10      6  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.I---S............G..F.FANSNK.Q.R..H.L.......      10      0      0     10      0      0      0      0      10      5  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1

Download

 

last modified: Thu Apr 21 17:09 2022



GISAID data provided on this website is subject to GISAID's Terms and Conditions
Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health