COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


XSpike

eXplore the Spike protein sequence in the SARS CoV-2 virus

Last update: Dec 6, 2022

Dates of current data

Delta and Omicron Variants
Global
Wuhan reference
Early 2021 Variants color key
Delta Variants color key
Delta Omicron Variants color key

Download

Evaluating 227629 sequences of length 1638
Sampled from 2022-10-07 to 2022-12-04.
Specified Date Range: ['2022-10-07', '2022-12-06']
Highest entropy sites for: Global
  Site Entropy
   346  0.7815
   444  0.7027
   460  0.6210
   486  0.3571
    69  0.2905
   452  0.2868
    70  0.2777
   446  0.2626
   339  0.2600
   147  0.2596
   144  0.2572
   257  0.2519
   152  0.2151
   157  0.2127
   210  0.1990
  1020  0.1887
   490  0.1738
   445  0.1634
   658  0.1597
   146  0.1257
   145  0.1162
   450  0.1157
   356  0.1151
   213  0.1134
   440  0.0967
   183  0.0949
    83  0.0880
   408  0.0875
   368  0.0827
     5  0.0772
   252  0.0730
   484  0.0703
   245  0.0607
   153  0.0572
  1263  0.0550
   417  0.0540
    19  0.0517
   255  0.0484
   164  0.0479
   181  0.0476
   666  0.0451
    76  0.0444
   142  0.0396
  1199  0.0388
  1162  0.0358
   619  0.0354
    27  0.0353
  1264  0.0343
    24  0.0332
    25  0.0322


Most highly correlated site-pairs for: Global
               cramerV  mutInfo
   444    460   0.3628   0.3405
    69     70   0.9984   0.2755
   486     69   0.3891   0.2393
   486     70   0.9496   0.2378
   446    339   0.4003   0.2323
   486    339   0.3901   0.2135
   486    446   0.3744   0.2099
    69    339   0.3713   0.2071
    70    339   0.9027   0.2062
   486    452   0.5460   0.2045
    69    446   0.3673   0.2027
    70    446   0.8967   0.2017
   257    152   0.4917   0.1881
   257    210   0.4930   0.1878
   152    210   0.4912   0.1868


   445    368   0.9945   0.0812
   183    368   0.9925   0.0807
    83    368   0.9909   0.0805
   145    368   0.9777   0.0773
   213    368   0.9680   0.0779
   146    368   0.8604   0.0688
   368    252   0.8560   0.0552
   452     70   0.8536   0.1828
    27     25   0.8345   0.0281
    70    257   0.8306   0.1679
    27     24   0.8254   0.0315
    24     25   0.7713   0.0270
    70    210   0.7704   0.1414
    70    152   0.7695   0.1403
    70    157   0.7653   0.1384


Most common patterns for local area, where Local = Global
                                             11111
         11111111111222222333344444444444466601122
 1222677844444555688114555345601444455688915626966
59457906324567237413035257966887045602046098602934
LTLPAHVTVGYYHKWMFNGQIVHGSGGRKLRKNKVGNLNEFFENIAPDPV  Global     UK  Eu-UK  NAmer   Asia Africa  SAmer  Ocean   Local  Exact  Pct [Context]
                                                    227629  15558  75904  85498  36530    668   2074  11397  227629 <----------- Totals
.I--S--..D...........G....D...SNK....R.AV.........   71461   2889  21655  28576  15102     52    142   3045   71461  54099  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV.........   30519   2655  14080  10310   2047    275    109   1043   30519  23346  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKT...RKAV.........   21830   2360   9083   7937   1587     88    153    622   21830  18137  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKAV.........   11321    797   2403   7253    398      8     91    371   11321   9617  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV....S....    8970    131   1112   1091   6523      1      6    106    8970   7294  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV..S......    6412    318   1104   4491    102     10     61    326    6412   5356  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SNKT...RKAV.........    4269    838   1397    981    344     39    296    374    4269   3676  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHTT.SNK..S..KA.S........    4071    619    818    978    952      2      9    693    4071   3234  79% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....DT..SNKT...RKAV.........    3370    457   2121    414    156      3     10    209    3370   2918  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK...DR.AV.........    2565    202   1274    877    137      2     10     63    2565   2013  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SNK....R.AV.........    2470    152    924    670    510      5      7    202    2470   1997  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...AD.Q-......E.E.V..HT.ISNK.PS..KASS........    2329    131    560    389   1106      8      8    127    2329   1933  82% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DI..SNK....R.AV.........    1891    195   1180    390     80      4      1     41    1891   1420  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DS..SNK....R.AV.........    1826    108    547    834    198      7      9    123    1826   1565  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNK....R.AV.........    1524    191    590    374    170     11      2    186    1524   1000  65% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKAV...V.....    1489    195    291    835     92      0      1     75    1489   1304  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I666V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D.....T.K...GN..DD...SNKR..DMKR..........    1486     53    474    464    238      4      2    251    1486   1058  71% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,N450D,L452M,N460K,S477N,T478K,E484R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....D...SNK....R.AV.........    1451     83    396    616    274      0      3     79    1451   1146  78% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK.A..R.AV.........    1288     99    389    615     82      2     21     80    1288   1014  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV.......Q.    1283    103    548    486    129      1      0     16    1283    970  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...R.AV.........    1157     69    332    548     82      6     12    108    1157    724  62% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKAV.Q.......    1092     55    263    729     16      0      4     25    1092    905  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E619Q,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SN.....R.AV.........    1010      0    478    314    108      0    110      0    1010    760  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHT..SNK..S..KAS.........     978     90    154    376    175      3      1    179     978    767  78% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHT..SNK..S..KAS......N..     961    158    145    348    186      1      3    120     961    695  72% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
.I--S--..D...........G....D...SNKM...R.AV.........     933    137    344    294    101      1      2     54     933    567  60% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKR...R.AV.........     897     34    334    434     62      1      7     25     897    692  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D...........G....D...SNK....R.AV.........     839     12     94    580    141      0      3      9     839    682  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S.RKAI.........     781      2      6     15     11      0      0    747     781    727  93% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,N460K,S477N,T478K,E484A,F486I,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.AV........L     736     93    316    236     82      4      1      4     736    560  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKN...RKAV.........     705     35    268    246     49      4     57     46     705    276  39% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...AD.Q-......E.E....HT.ISNK.PS..KASS........     665     82    178    167    202      1      8     27     665    252  37% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D........V..G....D...SNK....R.AV.........     632     18    161    378     51      0      0     24     632    534  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNKT.S.RKAS.........     594    184    106     71     94      0      0    139     594    433  72% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,G446S,L452R,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHT..SNK..S..KAPS........     563      8     33     13     12      0      0    497     563    527  93% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486P,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SN.....R.AV.........     513      0    297    132     67      1     16      0     513    392  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D.H.........G..F.D...SNK.A..R.AV.........     512      9     53    438      3      0      0      9     512    430  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....DT..SNK....R.AV.........     490     60    210    191     22      3      0      4     490    362  73% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK.A..R.AV.........     486      9     54    408     13      0      1      1     486    416  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...........G....D....NK....R.AV.........     431      0      0      0    431      0      0      0     431    309  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D....NK....R.AV.........     392      0    187     54     97      0     54      0     392    294  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D............AV.........     386      0      0    386      0      0      0      0     386    109  28% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNKN...R.AV.........     379     27    116    135     48      0      1     52     379    250  65% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G..F.D...SNKN...RKAV.........     377     35    214    106     14      1      1      6     377    322  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G..F.D...SNK....R.AV.........     377     27    157    131     53      0      0      9     377    302  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SNKN...RKAV.........     369     30     55    161     87      1     15     20     369    343  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S..KA..........     365     49     94     81     84      0      0     57     365    237  64% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-.-........G....D...SNK....R.AV.........     358     20    142    131     50      0      0     15     358    204  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D...........G....D...SNK...DR.AV.........     357      6     19    238     91      0      0      3     357    315  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNKR...R.AV.........     354     55    108    137     24      0      0     30     354    170  48% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,P209L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...-.......G....D...SNK....R.AV.....S...     331      0    331      0      0      0      0      0     331    312  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147-,N149-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
.I--S--..D...N.......G....DT..SNK....R.AV.........     309     96    123     45     40      0      0      5     309    258  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SH.T.SNK..S..KA..........     299     44     56     68     66      0      1     64     299    236  78% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D..L........G....D...SNKT...RKAV.........     242     19    111    106      4      0      2      0     242    211  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK..D.R.AV.........     238      7     84     65     70      3      0      9     238    153  64% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV.....S...     230      0     66    101     61      0      0      2     230    161  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNKRA..R.AV.........     229      0     21    181     25      1      0      1     229    207  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,P209L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..............G....DT..SN.....R.AV.........     218      0    196     10      7      0      5      0     218    168  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....D...SN.....R.AV.........     218      0    167     30     17      0      4      0     218    165  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.AV.....L...     202     16     45    104     32      1      0      4     202    129  63% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
.I--S--..D......L....G....D...SNK....R.AV.........     196     16     51     90     23      0      1     15     196    165  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S.RKAS......N..     192     28     42    104     13      0      3      2     192     92  47% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
.I--S....D...ER.L...VG...SH...SNKM.S.RKA..........     192      9     46     59      1      0      0     77     192    160  83% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,G446S,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.L--S--..D...........G....D...SNK....R.AV.........     189      2     60     69     56      0      0      2     189    161  85% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.....--..D...........G....D...SNK....R.AV.........     189      0    188      0      1      0      0      0     189    154  81% [H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DS..SNK....R.AV..S......     188      8    128     51      0      1      0      0     188    163  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..--S--..D...........G....D...SNK....R.AV.........     187      2    122     38     17      5      0      3     187     89  47% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....D...SNK...DR.AV.........     181     11     71     68     11      1      1     18     181    147  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT...........AV.........     176      0      0    175      0      1      0      0     176     68  38% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT...NKT...RKAV.........     175      0     25     18     62      1     69      0     175    146  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...I.......G....D...SNK....R.AV.........     174     15     58     84     14      0      2      1     174    147  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..S.KT...RKAV.........     170      0    108     44      2      0     16      0     170    144  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....D...SNKM...RKAV.........     166      7     18    130      8      0      0      3     166    153  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.H.........G....D...SNK....R.AV.........     157      6     32    104     11      0      0      4     157    123  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...T.......G....D...SNK....R.AV.........     151     12    109     15     13      0      0      2     151    100  66% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT...NK....R.AV.........     149      0     78     12     45      3     11      0     149    102  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D....L......G....DT..SNK....R.AV..S......     143     78     36     25      4      0      0      0     143    124  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....DT..SNKT...RKAV.........     141      4     62     64      6      2      0      3     141    116  82% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...N.......G....D...SNK....R.AV.........     139      2     96     22     19      0      0      0     139    116  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........V..G....DT..SNK....R.AV.........     139     11     95     26      1      0      0      6     139    107  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--SF-..D...........G....D...SNK....R.AV.........     137      3     70     31     28      0      0      5     137     94  68% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....D...SNK....R.AV....S....     134      3     18     17     96      0      0      0     134    125  93% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D....L......G....D...SNK....R.AV.........     132     13     33     75     10      0      0      1     132     75  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...E.......G....D...SNK....R.AV.........     131      2     56     57      9      0      0      7     131    100  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.L--S--..D...........G....DT..SNK....R.AV.........     129      2     53     67      6      0      0      1     129     76  58% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I.S.....D-.....-.............SNK..S.M.AP.........     128      3      0     15     10      0      0    100     128    113  88% [T19I,P25S,G142D,Y144-,E156G,F157-,R158-,P209L,L212S,D215H,A222V,A243-,L244-,S256L,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452M,S477N,T478K,E484A,F486P,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N703I,N764K,D796Y,Q954H,N969K] 
.....--..D...........G....DT..SNK....R.AV.........     128      0    128      0      0      0      0      0     128     91  71% [H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..--S--..D...........G....DT..SNKT...RKAV.........     126      2    110      5      1      4      0      4     126    103  81% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHTT..NK..S..KA.S........     123      1     14      2    100      1      5      0     123     85  69% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D..Y........G....D...SNK....R.AV.........     122      5     20     67     24      0      0      6     122     97  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AI.........     119      0    119      0      0      0      0      0     119    111  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486I,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,H1101Y] 
.I--S--..D...........G....DT..SN.....R.AV..S......     118      0     36     60      4      0     18      0     118     91  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G...DDT..SNK....R.AV.........     117      0      4      3    109      0      1      0     117     94  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G257D,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..............G....DT..SNKT...RKAV.........     116      0     70      9      0      0     37      0     116     98  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKM...RKAV.........     115      3     85     20      4      0      1      2     115     75  65% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV....S....     115      3     14      7     90      0      1      0     115     94  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKR...R.AV.........     115     24     35     39     15      0      0      2     115     71  61% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.ISH---..D...........G....DT..SNK....R.AV.........     114      0      0    114      0      0      0      0     114    109  95% [T19I,L24S,P25H,P26-,A27-,Y28-,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D...........G....DT..SNK....R.AV.........     114      1     75     29      9      0      0      0     114     95  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G.................AV.........     114      0      0    114      0      0      0      0     114     60  52% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK..S.R.AV.........     110     10     63     32      3      0      0      2     110     46  41% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E654K,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D....L......G....D...SNKT...RKAV.........     104      1      0    101      0      0      0      2     104    102  98% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNKN...RKAV..S......     104     44     24     12     11      2      0     11     104     80  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S..KAV.........     104     30     25     24     12      0      0     13     104     96  92% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L....-...SHTT.SNK..S..KA.S........     102     56      3     40      1      0      0      2     102     77  75% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,M177T,+209V,N211G,L212-,V213-,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,H1101Y] 
.I--S--..D...........G....DT..SNK....R.AV.......Q.     100      3     69     23      5      0      0      0     100     55  55% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK.A..R.AV..S......      98      0      5     84      0      2      2      5      98     88  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........GY...D...SNK....R.AV.........      98      2     44     36     14      0      0      2      98     79  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245Y,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S.RKAS.........      96     21     34     24     15      0      0      2      96     54  56% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...E.......G....DT..SNK....R.AV..S......      94      2      1     83      0      0      4      4      94     87  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SH.T.SNK..SD.KA.S........      93     14     39     12     11      0      2     15      93     84  90% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N450D,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....D...SNKT...RKAV.........      92      6     21     63      1      0      0      1      92     70  76% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D..-........G....D...SNK....R.AV.........      92      6     49     21      4      0      1     11      92     82  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G..F.DT..SNK....R.AV.........      89     12     31     38      4      0      0      4      89     80  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.....I.....G....D...SNK....R.AV.........      89      6     35     38      9      0      1      0      89     54  60% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.VV.........      86      2     28     48      8      0      0      0      86     62  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484V,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...S.KT...RKAV.........      86      0     44     30      0      0     12      0      86     81  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK....R.AV........L      85      6     37     34      3      1      0      4      85     48  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D..-........G....D...SNKT...RKAV.........      83     12     11     56      3      0      0      1      83     77  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV.......L.      82      0     31     37     12      0      0      2      82     58  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNK....R.AV..S......      80      7     15     49      3      0      0      6      80     67  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...N.......G....D...SNK...DR.AV.........      79      0     36     37      5      0      0      1      79     69  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....RSAV.........      79      0     15     59      4      0      0      1      79     46  58% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,T1116N] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S..KAS....S....      77      5     13     35     22      0      0      2      77     47  61% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
.I--S--..D...........G....D....NKT...RKAV.........      76      0     16     11     20      1     28      0      76     67  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D.......................      76      0      0     76      0      0      0      0      76     21  27% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DK..SNK....R.AV.........      75      1     56      8      5      5      0      0      75     59  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-.......V..G....DT..SNK....R.AV.........      74      0     69      5      0      0      0      0      74     65  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,G181V,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D-..........G....D...SNKT...RKAV.........      73     24     31     12      2      1      2      1      73     44  60% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....RSAV..S......      72      4     29     37      0      0      2      0      72     65  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK.A..R.AV....S....      72      6     43      7     16      0      0      0      72     50  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..--S--..D...........G....DT..SNK....R.AV.........      72      2     57      1      3      7      0      2      72     55  76% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D..Q........G....D...SNK....R.AV.........      72      3     14     52      3      0      0      0      72     36  50% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Q,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,V622F,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D-..........N...VDTT.SNK....RKA..........      72      1      7      3     44      0      0     17      72     67  93% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213N,+213GEG,G257V,G339D,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460K,G476-,T478N,+478K,E484A,Q498R,N501Y,Y505H,D614G,S640F,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D................D....NK....R.AV.........      71      0     19      0     52      0      0      0      71     23  32% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,S371F,S373P,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G.D..D...SNK....R.AV.........      68      0     18     40     10      0      0      0      68     55  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G252D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-....I.....G....DT..SNKT...RKAV.........      68      1      0     64      0      0      0      3      68     51  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,M153I,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DE..SNK....R.AV.........      66      2     38     21      1      0      4      0      66     60  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346E,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...E.......G....D...SNKT...RKAV.........      65      0     44     21      0      0      0      0      65     59  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-.....L....G....D...SNKT...RKAV.........      65      8     30     18      7      0      0      2      65     62  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--.FD...........G....D...SNK....R.AV.........      65     29     13      1     19      0      1      2      65     44  67% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V83F,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.........R.G....DT..SNK....R.AV.........      65      0     65      0      0      0      0      0      65     63  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183R,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...N.......G....D...SNK....R.AV....S....      65     15     33      9      1      0      0      7      65     47  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G..F.D...SNKT...RKAV.........      64      2     10     16     32      0      0      4      64     51  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..--S--..D-..........G....DT..SNKT...RKAV.........      64      1     62      0      0      1      0      0      64     57  89% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....D...SNKT...RKAV...V.....      63      4     30     12     16      0      0      1      63     54  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I666V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...I.......G....DT..SNK....R.AV..S......      63      5     40     15      2      0      1      0      63     59  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147I,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV..S......      62      6     14     26     12      1      1      2      62     43  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SNKT...RKAA.........      62      4     15     40      3      0      0      0      62     55  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...QR.L...VG...SHTT.SNK..S..KA.S........      62      0     48     13      1      0      0      0      62     54  87% [T19I,L24-,P25-,P26-,A27S,G142D,K147Q,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-.-........G....DT..SNK....R.AV..S......      62      0     20     38      1      0      2      1      62     54  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.........L.G....D...SNK....R.AV.........      62     16     10     31      3      0      0      2      62     50  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........R..G....D...SNK....R.AV.........      61      0     33     22      2      0      1      3      61     58  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D....R......G....D...SNK....R.AV.........      61      1     18     22     15      0      0      5      61     45  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....RYAV..S......      60      2      0     58      0      0      0      0      60     54  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460Y,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........GY...DT..SNK....R.AV.........      60      2     32     20      3      0      0      3      60     49  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245Y,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S.RKA..........      59      7     37      4      3      0      0      8      59     52  88% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SH...SNKM.S.RKAS.........      58      0      1     56      0      0      0      1      58     30  51% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,G446S,L452R,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G..F.DT..SNKT...RKAV.........      58      6     14     36      2      0      0      0      58     53  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........A..G....D...SNK....R.AV.........      58      6     24     21      7      0      0      0      58     48  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181A,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SNK....R.AV....S....      58      4     21     10     16      0      0      7      58     53  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I.----..D...........G....DT..SNK....R.AV.........      58      2     10     46      0      0      0      0      58     51  87% [T19I,P25-,P26-,A27-,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........E..G....D...SNK....R.AV.........      57      0     23     26      3      0      0      5      57     39  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...AD.Q-......E.E.V..HT.IS.K.PS..KASS........      57      0     15     33      7      0      2      0      57     44  77% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....D...SNK....R.AV.........      57      0     48      1      5      0      3      0      57     43  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...AD.K-......E.E.V..HT.ISNK.PS..KASS........      56      5     19     15     11      2      0      4      56     39  69% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145K,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...........G....DT..SNK....R.AV.........      56     30     12     10      3      0      0      1      56     38  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....DT..SNK....R.AV..S......      55     10      8     33      0      1      0      3      55     46  83% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKR...R.AV....S....      55      1     15     36      3      0      0      0      55     48  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SH...SNK..S..KA..........      55      9     15     14      8      0      0      9      55     32  58% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G..F.D...SNK.A..R.AV.........      54      1     12     38      0      0      0      3      54     28  51% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DS..SNKT...RKAV.........      53     20     28      3      2      0      0      0      53     51  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D....NKN...RKAV.........      53      0      1      0      0      0     52      0      53     33  62% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D.....T.....G....D...SNK....R.AV.........      52      1     15      5     27      0      0      4      52     45  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DI..SN.....R.AV.........      52      0     36     12      2      0      2      0      52     42  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S...AD.Q-......E.E.V..HT.ISNK.PS..KAPS........      51      0      6     45      0      0      0      0      51     49  96% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486P,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.AV....V....      50      1     31     14      4      0      0      0      50     41  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020V] Omicron_BA.4andBA.5
.I--S--..............G....D...SNKT...RKAV.........      48      0     23      6      0      0     19      0      48     40  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...........G....D...SNK......A..........      48      0     32      3     10      0      0      3      48     29  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.I--S....D...ER.L...VG...SHTT.SNK..S..KA..........      47      0      3     12      9      0      0     23      47     41  87% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...N.......G....DT..SNKT...RKAV.........      47     24     12     10      1      0      0      0      47     40  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..--S...AD.Q-......E.E....HT.ISNK.PS..KASS........      46      0      0      0     46      0      0      0      46     34  73% [L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-.-........G....D...SNK...DR.AV.........      45     34      3      8      0      0      0      0      45     36  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DS..SNK....R.AV........L      43      2      1     40      0      0      0      0      43     35  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV.......L.      43      8     17     17      0      0      0      1      43     36  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK...DR.AV..S......      43      0     43      0      0      0      0      0      43     36  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT...NK....R.AV..S......      43      0      8     10      2      0     23      0      43     35  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DS..SN.....R.AV.........      43      0     10      6     21      0      6      0      43     34  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....DS..SNK....R.AV.........      42      4     13     11     11      0      0      3      42     33  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.H.........G....D...SNKT...RKAV.........      41      4      8     29      0      0      0      0      41     41 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SN.....R.AV.........      40      0     18      9      5      0      8      0      40     30  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.AI.........      40      4      1      6     29      0      0      0      40     39  97% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486I,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....D...SNK....R.AV.......Q.      40      7     17     12      4      0      0      0      40     29  72% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
.I--S--..D................D...SNK....R.AV.........      40      0     38      2      0      0      0      0      40     20  50% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK....R.AV.....S...      39      4     18      3     11      2      0      1      39     28  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
.I--S--..D..-........G....DT..SNKT...RKAV.........      39      2     11     26      0      0      0      0      39     36  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNK.A..R.AV.........      39      0      3     34      1      0      1      0      39     30  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,A262S,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKVV...V.....      39      1      1     37      0      0      0      0      39     36  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484V,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I666V,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I.----..D...........G....D...SNK....R.AV.........      39      1      8     11     14      0      0      5      39     32  82% [T19I,P25-,P26-,A27-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....D...SNKT...RKAV...V.....      39      1     28      5      2      0      1      2      39     37  94% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I666V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKQ...R.AV.........      39      2      2     10      4      0      0     21      39     35  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444Q,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G...SD...SNK....R.AV.........      38      0      2     11     11      0      0     14      38     37  97% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G257S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........E....D...SNK....R.AV.........      38      0     19     17      1      0      0      1      38     32  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D.....T.K...GN..DD...SNKR.SDMKRS.........      38      1      1     28      7      0      0      1      38     35  92% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,G446S,N450D,L452M,N460K,S477N,T478K,E484R,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G.SF.D...SNKN...RKAV.........      38      1     11      7      2      0      0     17      38     36  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G252S,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D.H.........G....D...SNK....R.AV.........      38      0     33      1      4      0      0      0      38     36  94% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--SS...D...........G....DT..SNK....R.AV.........      37      9     16      9      3      0      0      0      37     36  97% [T19I,L24-,P25-,P26-,A27S,H69S,S71-,G72-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...S.KT...RKAV.........      37      0     30      4      3      0      0      0      37     34  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D....R......G....DT..SNKT...RKAV.........      36      3      3     30      0      0      0      0      36     34  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152R,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........R..G....DT..SNKT...RKAV.........      36      2     13     20      1      0      0      0      36     35  97% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181R,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-.-........G....DT..SN.....R.AV..S......      36      0      0      0      0      0     36      0      36     26  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........GY...D...SNKT...RKAV...V.....      36      0      0     35      0      0      0      1      36     27  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245Y,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I666V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...E.......G....DT..SNKT...RKAV.........      36      3     24      8      0      0      0      1      36     36 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...AD.Q-......E.E....HT.I.NK.PS..KASS........      36      0      1      2      7      0     26      0      36     23  63% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,D253G,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........E....D...SNK...DR.AV.........      35      0      0     35      0      0      0      0      35     32  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,L179F,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,F1075L] 
.I--S--..D-..........G....D...SNKR...R.AV.........      35      8     20      5      1      0      1      0      35     28  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....RYAV.........      35      3     16     10      5      0      0      1      35     31  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460Y,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........GN...D...SNK....R.AV.........      35      0     12     12      1      0      0     10      35     24  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245N,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D......L....G....DT..SNK....R.AV.........      35      1     11      6     15      0      0      2      35     31  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D-.-........G....D...SNK....R.AV.........      35      0      0     33      2      0      0      0      35     34  97% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SN.....R.AV....S....      34      0     21     10      1      0      2      0      34     27  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
.I--S....D...........G....D...SNK....R.AV.........      34      1      3     26      4      0      0      0      34     18  52% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,P812S,Q954H,N969K,D1260Y] Omicron_BA.4andBA.5
.I--S--..D-..........G....D...SNKT...RKAV.Q.......      34      0     13     21      0      0      0      0      34     28  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E619Q,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G..F.D...SNK....R.AV....S....      34      1     18     12      2      0      1      0      34     28  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D-.-........G....D...SNKR...R.AV.........      34      0      6     28      0      0      0      0      34     32  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G..F.D...SNK....R.VV.........      34      0      3     31      0      0      0      0      34     34 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484V,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G............................      34      0      0     34      0      0      0      0      34     12  35% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....DS..SNK....R.AV.........      33      0      7     20      6      0      0      0      33     17  51% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....Q.AV.........      32      5     10     10      7      0      0      0      32     29  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-.-.....E..G....D...SNK....R.AV.........      32      1      1     30      0      0      0      0      32     25  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....D...SNKT...R.AV.........      32      8      4     18      1      0      0      1      32     18  56% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV.....L...      32      5     13     13      1      0      0      0      32     29  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
.I--S--..D-..........G....D....NKT...RKAV.........      32      0      3      1     10      0     18      0      32     28  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK.F..R.AV..S......      32      0      0     14      0      0      1     17      32     31  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445F,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....D....NKN...RKAV.........      32      0      0      0      0      0     32      0      32     31  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D.......K...G....DT..SNK....R.AV..S......      32      0      0     32      0      0      0      0      32     27  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,N164K,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKTA..RKAV.........      31      0      1     30      0      0      0      0      31     29  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,V445A,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..............G....DT..SNK....R.AV.........      31      0     29      0      1      0      1      0      31     23  74% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........GR...D...SNK....R.AV.........      31      0      5     26      0      0      0      0      31     25  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245R,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D..Q........G....DT..SNK....R.AV.........      31      1     27      3      0      0      0      0      31     23  74% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Q,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SH...SNK..S.RKA..........      31      5     10     12      3      0      0      1      31     22  70% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...........G....D....NK....R.AV....S....      31      0      0      0     31      0      0      0      31     18  58% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
.I--S--..D...........G....D..........R.AV.........      31      0      0     31      0      0      0      0      31     19  61% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK....RHAV.........      31      0     29      0      0      0      0      2      31     30  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460H,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNKT...RKAVS........      30      0      0     30      0      0      0      0      30     29  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AA.........      30      2     20      4      0      0      0      4      30     12  40% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNKT...RKAV.....L...      30      3     15      8      4      0      0      0      30     21  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
.I--S--..D-..........G....DI..SNK....R.AV.........      30     12     12      1      5      0      0      0      30     24  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D..-........G....DT..SNK....R.AV.........      30      1     26      1      0      0      0      2      30     25  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D....NK....R.AV....S....      30      0     11      1     15      0      3      0      30     27  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
.I--S--..D...........G...DD...SNK....R.AV.........      29      0     14      7      8      0      0      0      29     22  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....D...SNK...DR.AV.........      29      2     13     11      2      0      0      1      29     19  65% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...A..Q-......E.E.V..HT.ISNK.PS..KASS........      29      0      6      5     17      0      1      0      29     21  72% [T19I,L24-,P25-,P26-,A27S,V83A,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SN....DR.AV.........      29      0     17     10      0      0      2      0      29     24  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...........G....DT...NK....R.AV.........      29      0      0      0     29      0      0      0      29     22  75% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...Q.......G....D...SNK..D.RKAV.........      29      0      0      3     26      0      0      0      29     29 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147Q,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKAV.......Q.      28      1      6     19      0      0      2      0      28     23  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
FI--S--..D-..........G....D...SNK....R.AV.........      28      2      9      8      5      0      1      3      28     23  82% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D...........G....D...SNK....R.AV....S....      28      1      2      3     22      0      0      0      28     26  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV....SL...      28      0      2      0     26      0      0      0      28     26  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,P1162L] Omicron_BA.4andBA.5
.I--S--..D................DT..SNK....R.AV.........      28      0     28      0      0      0      0      0      28     16  57% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.-...VG...SH.T.SNK..S..KA.S........      28      0     28      0      0      0      0      0      28     26  92% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,E156-,F157-,I210V,V213G,G257S,G339H,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT...........AV..S......      28      0      0     28      0      0      0      0      28     11  39% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....D...SNK.A..R.AV.........      27      0      8     13      1      0      5      0      27     22  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..S.KT...RKAV.........      27      0     18      5      2      0      2      0      27     23  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK.F..R.AV.........      27      0      4     16      5      0      0      2      27     26  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445F,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S...AD.Q-......E.E.V..HT.ISNK.PS..KASS........      26      2      0      0     23      0      0      1      26     24  92% [L5F,T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNKN...RKAV.....L...      26      7     18      1      0      0      0      0      26     22  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K150E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.VV.........      26      0     22      2      2      0      0      0      26     20  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484V,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D......L....G....DT..SNKT...RKAV.........      26      0      4     22      0      0      0      0      26     26 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D.....T.K...GN..DD...SNKR..DMKRS.........      26      0      0      1     19      0      0      6      26     23  88% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,N450D,L452M,N460K,S477N,T478K,E484R,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........E....DT..SNK....R.AV.........      26      0      3     11     12      0      0      0      26     20  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K182E,V213E,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D....N.......AV.........      26      0      0     26      0      0      0      0      26     11  42% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT......................      26      0      0     26      0      0      0      0      26      8  30% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DI..SNK....RKAV.........      25      0     19      4      0      0      2      0      25     22  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.........K.G....D...SNK....R.AV.........      25      0     14      4      7      0      0      0      25     19  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG....HTT.SNK..S..KA.S........      25      0      1      0     24      0      0      0      25     16  64% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHST.SNK..S..KA..........      25     16      1      6      2      0      0      0      25     24  96% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346S,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D.H.ER.L...VG...SHTT.SNK..S..KA.S........      24      0      1     15      6      0      0      2      24     21  87% [T19I,L24-,P25-,P26-,A27S,G142D,Y145H,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHT..SNK..S..KASS........      24      3      7      5      8      0      0      1      24     16  66% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK..V.R.AV.........      24      1     11     10      2      0      0      0      24     17  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446V,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.H.........G....DT..SNK....R.AV.........      24      1      5     17      1      0      0      0      24     18  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SN.....RKAV.........      24      0      2     13      1      0      8      0      24     14  58% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SH.T.SNK..SD.KA..........      24     17      6      0      0      0      0      1      24      8  33% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N450D,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK....R.AV........M      24      4     19      1      0      0      0      0      24     18  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264M] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SH...SNKT.S.RKA..........      24      4      0      2     13      0      0      5      24     21  87% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,G446S,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D.T.SNK....R.AV.........      24      1      2     16      5      0      0      0      24     22  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNKM.S.RKAS......N..      24      1      2     21      0      0      0      0      24     18  75% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,G446S,L452R,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
.I--S--..D...........G....DI..SNKT...RKAV.........      24      3     10      5      0      2      0      4      24     24 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKTA..RKAV.........      24      0      1     22      0      0      0      1      24     23  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,V445A,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SN.....R.AV........L      24      0     16      7      0      0      1      0      24     20  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
.I--S--..D.H.........G....DT..SNKT...RKAV.........      23      3      6     13      1      0      0      0      23     16  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.L--S--..D...........G....DT..SNKT...RKAV.........      23      3     19      1      0      0      0      0      23     21  91% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..--S....D...ER.L...VG...SHTT.SNK..S..KA.S........      23      0      1      0      5     12      0      5      23     17  73% [L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--...-..........G....DT..SNKT...RKAV.........      23      0     19      1      1      0      2      0      23     21  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DI..SNK....RHAV.........      23      0     10      0      1      0      0     12      23     21  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460H,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VE...SHT..SNK..S..KAS......N..      23      0      2      3      3      0      0     15      23     19  82% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213E,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
.I--S--..D...........G....DT..SNK....R.AV..S.S....      23      0      1     22      0      0      0      0      23     22  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT...........AV.........      23      0      0     23      0      0      0      0      23      9  39% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D.....K....R.AV.........      23      0      0     22      1      0      0      0      23     11  47% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...S.K....R.AV.........      23      0     15      6      2      0      0      0      23     19  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D........V..GY...D...SNK....R.AV.........      23      0     23      0      0      0      0      0      23     16  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,H245Y,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S....D...ER.L...VG...SHTT.SNK..S..KA.S........      22      3      6      7      4      0      0      2      22     17  77% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--I.D...........G....D...SNK....R.AV.........      22      0      0     21      1      0      0      0      22     17  77% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.A..........      22      0      5     14      3      0      0      0      22      9  40% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D..Y........G....DS..SNK....R.AV.........      22      0      3      0     19      0      0      0      22     15  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........GY...DT..SNKT...RKAV.........      22      3     17      2      0      0      0      0      22     19  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245Y,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--SA-..D...........G....DT..SNK....R.AV.........      22      0      0     22      0      0      0      0      22     21  95% [T19I,L24-,P25-,P26-,A27S,H69A,V70-,S71-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D..Y........G....DT..SNK....R.AV.........      22     13      5      3      1      0      0      0      22     13  59% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AA.........      22      1      1     17      3      0      0      0      22     17  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHT..SNK..S..KA.S........      22      1      4     11      2      0      0      4      22      8  36% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........R....D...SNK....R.AV.........      22      1      6     12      3      0      0      0      22     20  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213R,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S........ER.L...VG...SHTT.SNK..S..KA.S........      22      0     10      0     12      0      0      0      22     17  77% [T19I,L24-,P25-,P26-,A27S,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....D...SN.....R.AV....S....      22      0     18      3      0      0      1      0      22     18  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
.I--S--..D...........G....DS..SNK....R.AV....S....      22      1     16      1      4      0      0      0      22     17  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...-.......G....D...SNK....R.AV.........      22      8     10      4      0      0      0      0      22     21  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147-,N149-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SN.T...RKAV.........      22      0      7      8      0      0      7      0      22     18  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D....L......G....DT..SNK....R.AV.........      21      1      2     11      6      0      0      1      21     11  52% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........V..G....D...SNK...DR.AV.......Q.      21      4      5     11      1      0      0      0      21     19  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
.I--S--..D...........-....D...SNK....R.AV.........      21      0      5     11      1      0      0      4      21     15  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,N211I,L212G,V213-,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK....R.AV..S.....L      21      0      0     13      0      0      0      8      21     20  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D-.......V..G....D...SNK....R.AV.........      21      5      9      6      1      0      0      0      21     19  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...N.......G....D....NKN...RKAV.........      21      0      0      0      0      0     21      0      21     21 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DS...........AV.........      21      0      0     21      0      0      0      0      21      7  33% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I......AD..Q......E.E....HT.ISNK.PS..KASS........      21      0      0      0     21      0      0      0      21     12  57% [T19I,V83A,G142D,H146Q,Q183E,V213E,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D.H.........G....D...SNKR...R.AV.........      20     16      3      1      0      0      0      0      20     18  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.V--S--..D...........G....DT..SNK....R.AV.........      20      0     17      3      0      0      0      0      20     19  95% [T19V,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK....RSAV.........      20      3     12      5      0      0      0      0      20     16  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D....NK.A..R.AV.........      20      0      2      2      1      0     15      0      20     16  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D..........TG....D...SNK....R.AV.........      20      0     17      3      0      0      0      0      20     17  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,I210T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...........G....DT..SNK....R.AV....S....      20      1      5     14      0      0      0      0      20     18  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV.......R.      20      0     12      2      5      0      0      1      20     18  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263R] Omicron_BA.4andBA.5
FI--S--..D...........G....D...SNK.A..R.AV.........      19      0      6     12      0      0      0      1      19     16  84% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.........P.G....D...SNK....R.AV.........      19      1      4     12      1      0      0      1      19     18  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183P,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..--S...AD.Q-......E.E.V..HT.ISNK.PS..KASS........      19      0      1      0     18      0      0      0      19     18  94% [L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....DI..SNK....R.AV.........      19      0     13      3      2      0      1      0      19      9  47% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.Q-........G....DT..SNKR...R.AV.........      19      0     12      0      7      0      0      0      19     18  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145Q,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.SV.........      19      0      9      5      2      0      0      3      19     17  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484S,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..S.K....R.AV.........      19      0     13      6      0      0      0      0      19     17  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SH...SNKT.S..KAV.........      18      0      3     10      5      0      0      0      18     15  83% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,G446S,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....D...SN....DR.AV.........      18      0     15      3      0      0      0      0      18     12  66% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--I.D...........G....D...SNK....R.AV........L      18      0      0     18      0      0      0      0      18     16  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D...........G....D...S.KT...RKAV...V.....      18      0     10      6      2      0      0      0      18     13  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I666V,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNKT...R.AV.........      18      0     15      1      2      0      0      0      18     14  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKR...R.AV..S......      18      0      3     14      0      0      1      0      18     17  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--...-..........G....D...SNKT...RKAV.........      18      0     12      0      1      0      5      0      18     15  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D.....T.K...GN..DD....NKR..DMKR..........      18      0      2      1     15      0      0      0      18     10  55% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444R,N450D,L452M,N460K,S477N,T478K,E484R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D........V..G....DT..SNK....R.AV..S......      18      1     11      5      0      0      1      0      18     16  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV....V....      18      1      8      8      1      0      0      0      18     13  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020V] Omicron_BA.4andBA.5
.I--S....D.....T.K...GN..DD...SNKR..DMKR.........L      18      2      1      1      4      0      0     10      18     17  94% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,N450D,L452M,N460K,S477N,T478K,E484R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
.I--S--..............G....D.......................      18      0      0     18      0      0      0      0      18      6  33% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....DT...NKT...RKAV.........      17      0      8      0      7      0      2      0      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...Q.......G....D...SNK....R.AV.........      17      0      0     15      2      0      0      0      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147Q,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV....S..L.      17      0      5      0     12      0      0      0      17     15  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,P1263L] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK.AS..KA..........      17      0      0      9      8      0      0      0      17     17 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--SF-..D...........G....D...SNKN...RKAV.........      17      3     10      1      1      0      0      2      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,K150E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.....V.....G....D...SNK....R.AV.........      17      2      7      7      1      0      0      0      17     12  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K150N,M153V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S....D...ER.L.A.VG...SHT..SNK..S..KAS.........      17     14      3      0      0      0      0      0      17     13  76% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,G181A,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SH.T.SNK..S..KA.S........      17      0      6      5      0      0      0      6      17     10  58% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--SF-..D...........G....DT..SNK....R.AV.........      17      1      4      3      7      0      1      1      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..............G....DT..SN.....R.AV..S......      17      0     13      0      1      0      3      0      17      8  47% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D-..........G....D....NK....R.AV.........      17      0      0      0     17      0      0      0      17     14  82% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D......L....G....DT..SNK....R.AV..S......      17      6      2      9      0      0      0      0      17     14  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..............G.................AV.........      17      0      0     17      0      0      0      0      17      6  35% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.I--S--..D................DT...NK....R.AV.........      17      0     16      0      1      0      0      0      17      5  29% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SN.......AV.........      17      0      4     12      0      1      0      0      17      9  52% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--I.D......L....G....D...SNK....R.AV.........      17      0      0     17      0      0      0      0      17     17 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.....--..D...........G....DI..SNK....R.AV.........      17      0     17      0      0      0      0      0      17     15  88% [H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...I.......G....DT..SNKT...RKAV.........      16      0     10      4      2      0      0      0      16     11  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147I,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D-..........N...VDT..SNK....RKA..........      16      2      4      2      6      0      0      2      16     12  75% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213N,+213GEG,G257V,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460K,G476-,T478N,+478K,E484A,Q498R,N501Y,Y505H,D614G,S640F,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....D...SNKT...RKAV.......L.      16      5      3      0      8      0      0      0      16     14  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D...N.I.....G....D...SNK....R.AV.........      16      3     12      1      0      0      0      0      16     12  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,E1258Q] Omicron_BA.4andBA.5
.I--S--..D...........G..F.DT..SNK....R.AV..S......      16      0      0     14      0      0      0      2      16     10  62% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.........H.G....D...SNK....R.AV.........      16      0      5      0     11      0      0      0      16     13  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D....NK...DR.AV.........      16      0     12      2      1      0      1      0      16     11  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-.......V..G....DT..SNK..S.R.AV.........      16      0     16      0      0      0      0      0      16     16 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,G181V,L212F,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1084E] Omicron_BA.4andBA.5
.I--S--..---.........G....DT..SNK....R.AV.........      16      4      3      8      0      0      1      0      16     11  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,D138-,P139-,F140-,L141-,G142-,V143-,Y144-,Y145-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNK..S.R.AV.........      16     15      1      0      0      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.-...VG...SHT..SNK..S..KAS......N..      16      0     16      0      0      0      0      0      16     14  87% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,E156-,F157-,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
.I--S--..D-..........G....D....NK....R.AV.........      16      0      5      0      2      0      9      0      16     12  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....DI..SN.....R.AV.........      16      0     16      0      0      0      0      0      16     12  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--SS...D...........G....D...SNK....R.AV....S....      15      0      0      0     15      0      0      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69S,S71-,G72-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G....NT..SNKT...RKAV.........      15      3      2     10      0      0      0      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339N,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-..........G....DT..SN.....R.AV.........      15      0      6      3      4      0      2      0      15     11  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D.........R.G....D...SNK....R.AV.........      15      2      9      3      1      0      0      0      15     12  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..--S....D...ER.L...VG...SHT..SNK..S..KAS.........      15      0      0      0     12      3      0      0      15      9  60% [L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--SF-..D...........G....D...SNKT...RKAV.........      15      0      9      6      0      0      0      0      15      8  53% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHTT.S.K..S..KA.S........      15      0      1      1     13      0      0      0      15     15 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.AV.Q.......      15      0      5      7      3      0      0      0      15     12  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E619Q,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G.S..D...SNK....R.AV.........      15      0      9      5      1      0      0      0      15     12  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G252S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D...........G....D...SN.....R.AV.........      15      0     10      4      1      0      0      0      15      9  60% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...E.......G....DT..SNK.A..R.AV.........      15      0     15      0      0      0      0      0      15     15 100% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D...........G....DK..SNK....R.AV.........      15      0     15      0      0      0      0      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,D215E,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D..Y........G....DT..SNKT...RKAV.........      14      2      1      9      2      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK.L..R.AV.........      14      0      0     12      2      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445L,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKR...R.AV.......Q.      14      0      1      5      8      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK...DR.AV........L      14      0      0      3     11      0      0      0      14      8  57% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D........V..G....DT..SNKT...RKAV.........      14      1      3      9      1      0      0      0      14     11  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK..D.R.AV.........      14      0      2     12      0      0      0      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,A570T,D614G,H655Y,N679K,P681H,N764K,D796Y,L822V,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SH...SNKT...RKA..........      14      0      0     14      0      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK..S.R.AV.........      14      1      6      3      4      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D..-........G....DT..SNK....R.AV..S......      14      1     11      2      0      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.R.......D....L.-....G....D...SNK..D.R.AP.........      14      1      7      2      0      4      0      0      14      6  42% [L18F,T19R,R21G,T95I,G142D,W152L,E156G,F157-,R158-,F186L,V213G,D253G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,L452R,S477N,T478K,E484A,F486P,Q498R,N501Y,Y505H,D614G,P621S,H655Y,N679K,P681H,A706V,N764K,D796Y,Q954H,N969K,T1117I] 
.I--S--..D...........G....D....NKM...R.AV.........      14      0      4      0      1      0      9      0      14      9  64% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444M,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G.V..D...SNK....R.AV.........      14      0      6      3      5      0      0      0      14      6  42% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G252V,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...........G....DT...NKT...RKAV.........      14      0      0      0     14      0      0      0      14      8  57% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.TV.........      14      0      1      3     10      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484T,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....R.AV.K.......      14      0      6      6      1      0      0      1      14     14 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E619K,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK.F..R.AV.........      14      4      4      5      0      0      0      1      14     14 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445F,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S-...D...........G....D...SNK....R.AV.........      14      0      1     12      1      0      0      0      14     11  78% [T19I,L24-,P25-,P26-,A27S,I68-,H69-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.........L.G....DT..SNK....R.AV.........      14      0     14      0      0      0      0      0      14      7  50% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q183L,P209L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,Q787H,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D.....T.K...EN..DD...SNKR..DMKR..........      14      0      0      1      9      0      0      4      14     13  92% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213E,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,N450D,L452M,N460K,S477N,T478K,E484R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S...AD.Q-......E.E....HT.IS.K.PS..KASS........      14      0      5      2      6      0      1      0      14      5  35% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK....RYAV.........      14      0      3     11      0      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460Y,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--I.D...........G....DS..SNK....R.AV.........      14      1      2     11      0      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.......T...G....D...SNKT...RKAV.........      14      0      0     13      0      0      0      1      14     13  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,N164T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D................DT..SNKT...RKAV.........      14      0     13      0      1      0      0      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNKT...RKAV........L      13      1      4      6      2      0      0      0      13      8  61% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKT...RKAV.......L.      13      3      5      5      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKT...RKAV.......S.      13      0      0     13      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263S] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....R.AV..S..S...      13      0      0     13      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
.I--S--I.D-..........G....D...SNK....R.AV.........      13      1      0     12      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D-..........G....DT..SNKT...RKAV.........      13      1     10      1      1      0      0      0      13     13 100% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S--..D-..........G....DT..SNK....R.AV.........      13      4      4      3      1      0      0      1      13     10  76% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKT...RKAV.Q.......      13      0     11      0      0      0      0      2      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E619Q,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S...AD.Q-......E.E....HT.ISNKRPS..KASS........      13      1      5      4      3      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D......S....G....DT..SNK....R.AV.........      13      0      7      0      0      0      0      6      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157S,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.....T.....G....D...SNK....R.AV....S....      13      0     10      1      2      0      0      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SN.....R.AV.......Q.      13      0      9      4      0      0      0      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] 
.I--S--...-..........G....D...SN.....R.AV.........      13      0     10      2      1      0      0      0      13      9  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DI...NK....R.AV.........      13      0      8      1      3      0      1      0      13     10  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L.V.VG...SHT..SNK..S..KAS......N..      13      0      2      0      5      0      0      6      13     12  92% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,G181V,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
FI--S--..D...........G....D....NK....R.AV.........      13      0     11      0      1      0      1      0      13     11  84% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G.D..DT..SNKT...RKAV.........      13      0     10      3      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G252D,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...SHT..SNK..S..KA.L........      13      0     12      1      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490L,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT....KT...RKAV.........      13      0      2     10      1      0      0      0      13      5  38% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.-...VG...SH.T.SNK..SD.KA.S........      13      0     13      0      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,E156-,F157-,I210V,V213G,G257S,G339H,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N450D,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.-...VG...SHTT.SNK..S..KA.S........      13      0     13      0      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,E156-,F157-,I210V,V213G,G257S,G339H,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNK......AV.........      13      0      7      4      2      0      0      0      13      6  46% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S-...D...........G....D...SNK....R.AV.........      12      0      1     11      0      0      0      0      12     10  83% [L5F,T19I,L24-,P25-,P26-,A27S,I68-,H69-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKVV.........      12      0      3      9      0      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484V,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...E.......G....DT..SNK....R.AV.........      12      2      4      2      4      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........V..G....DS..SNK....R.AV.........      12      0      6      5      1      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........GY...D...SNK....R.AV....S....      12      0      2      0     10      0      0      0      12     12 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,H245Y,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S...AD.Q-......E.E.V..HT.I.NK.PS..KASS........      12      0      2      0     10      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y145Q,H146-,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-.....L....G....D...SNK....R.AV.........      12      0      3      2      6      0      0      1      12      9  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKT...RKAV.......L.      12      0      6      3      3      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D.H.........G..F.D....NK.A..R.AV.........      12      0      1     11      0      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNKT...RKAV......H..      12      0      0     12      0      0      0      0      12     12 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199H] Omicron_BA.4andBA.5
.I--S--..D...........G....D............AV.......Q.      12      0      0     12      0      0      0      0      12      4  33% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] 
.I--S--..D...........G....D...SN.T...RKAV.........      12      0      3      8      0      0      1      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....D...SNK....R.AV........L      12      0      3      7      2      0      0      0      12     12 100% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK.AS.R.AV.........      12      0      0     11      1      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........E..G....D...SNK....R.AV..S......      12      0      0      0      1      0      0     11      12      9  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,Q1201L] Omicron_BA.4andBA.5
.I--S--..D.....I.....G....D...SNK....R.AV....S....      12      0      0      0     12      0      0      0      12     12 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S...AD..Q......E.E.V..HT.ISNK.PS..KASS........      11      0      5      3      2      0      0      1      11      9  81% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,H146Q,Q183E,V213E,G252V,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,N460K,S477N,T478K,E484A,F486S,F490S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SHT..SNK..S..KAP.........      11      0      0      5      6      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486P,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D....R......G....DT..SNK....RSAV..S......      11      0     11      0      0      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152R,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,D1153G] Omicron_BA.4andBA.5
.I--S--..D-.-........G....D...SNKT...RKAV.........      11      0      3      8      0      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.PV.........      11      0     10      0      0      0      1      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484P,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....YT..SNK....R.AV.........      11      0      9      2      0      0      0      0      11      5  45% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339Y,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1078S] 
.I--S--..D...........G....D...SNKT...RKA..........      11      0      1     10      0      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D-....I.....G....D...SNK....R.AV.........      11      1      2      6      2      0      0      0      11      6  54% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKM...RKAV.........      11      1      4      2      2      0      0      2      11      6  54% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.....--..D--..............DK...NK..S...A..........      11      0      6      5      0      0      0      0      11      8  72% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
FI--S--..D...........G....D...SNKN...R.AV.........      11      0      6      2      1      0      0      2      11      9  81% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNKT.S.RKAV.........      11      8      0      3      0      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,G446S,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....DT..SNK....RKAV.........      11      1      4      4      2      0      0      0      11      7  63% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...R.......G....D...SNK....R.AV.........      11      1      8      0      2      0      0      0      11      6  54% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G........SNK....R.AV.........      11      1      8      1      0      1      0      0      11      5  45% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNKT...RK...........      11      0      2      4      5      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I...--..D...........G....D...SNK....R.AV.........      11      0     10      1      0      0      0      0      11      5  45% [T19I,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S--..D...........G....D...SNKN...RKAV.........      11      0      2      7      0      0      1      1      11      8  72% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...S.KN...R.AV.........      11      0      7      3      0      0      1      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--SF-..D...........G....D...SNK....R.AV....S....      11      0      0      1     10      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.I--S--...-..........G....DT..SN.....R.AV.........      11      0     10      1      0      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....DT..SN.....RKAV.........      11      0      0      3      0      0      8      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..............G....DT..SN.T...RKAV.........      11      0      0      7      0      0      4      0      11      7  63% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DS..SNK.A..R.AV.........      11      0     11      0      0      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Q173K,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,I624L,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNK....R.AV....SS...      11      1      0      3      7      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,P1162S] Omicron_BA.4andBA.5
.I--S....D...........G....DT..SNK.A..R.AV.........      11      0      0     11      0      0      0      0      11      5  45% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...E.......G....D...SNKT...RKAV.......L.      10      0      0      0      9      0      0      1      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D...........G....DS..SNKR...R.AV.........      10      1      0      6      1      0      1      1      10      5  50% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D.H.........G....D...SNK...DR.AV.........      10      0      2      8      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...I.......G....DT..SN.....R.AV..S......      10      0      0      0      0      0     10      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147I,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...-HT..SNKT.S.RKAS.........      10      1      0      0      1      0      0      8      10      8  80% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,+254P,G257-,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,G446S,L452R,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S....D...ER.L...VG...SHT..SNK..S..KAS.........      10      3      0      5      0      0      0      2      10      7  70% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..--S....D...ER.L...VG...SHT..SNK..S..KAS......N..      10      0      1      0      9      0      0      0      10      7  70% [L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
..--S....D...ER.L...VG...SHT..SNK..S..KA..........      10      0      0      0      8      2      0      0      10      7  70% [L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
FI--S....D...ER.L....-...SHT..SNK..S..KAS......N..      10      0     10      0      0      0      0      0      10     10 100% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,+209V,N211G,L212-,V213-,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
.I--S--..D...........G....D...SNK....R.AV.......S.      10      1      3      2      4      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263S] Omicron_BA.4andBA.5
.I--S--..D...........G..P.D...SNK....R.AV.........      10      2      4      4      0      0      0      0      10      7  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255P,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D........V..G....D...SNK...DR.AV.........      10      3      7      0      0      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D....NKT...R.AV.........      10      0      2      3      3      0      2      0      10      7  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....DT..SNK..V.R.AV.........      10      1      5      2      1      0      1      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446V,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--SF-..D.N.........G....DT..SNK....R.AV..S......      10      4      6      0      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,Y145N,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.L--S--..D...........G....D...SNK....R.AV.......Q.      10      1      9      0      0      0      0      0      10      8  80% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] 
.I--S--I.D-.-........G....D...SNK...DR.AV.........      10      0      0     10      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G75V,T76I,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...ER.L...VG...-HT..SNK..S..KAS.........      10      5      4      1      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,+255L,G257-,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
-I--S--..D...........G....D...SNK....R.AV.........      10      0     10      0      0      0      0      0      10      7  70% [L5-,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D...........G....D...SNK....Q.A..........      10      0      8      1      1      0      0      0      10      5  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.I--S--..D..L........G....D...SNK....R.AV.........      10      0      1      3      5      0      0      1      10      9  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
FI--S....D-..........N...VDTT.SNK....RKA..........      10      0      0      0      0      0      0     10      10      9  90% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,Y144-,G184V,V213N,+213GEG,G257V,G339D,R346T,K356T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460K,G476-,T478N,+478K,E484A,Q498R,N501Y,Y505H,D614G,S640F,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--SF-..D...........G....DT..SNKT...RKAV.........      10      0      4      4      2      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69F,V70-,S71-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S--..D...........G....D...SNKQ...R.AV.......QL      10      2      8      0      0      0      0      0      10      5  50% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444Q,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q,V1264L] Omicron_BA.4andBA.5
.I--S--..D-..........G....DT..SNKT...RKAV.......L.      10      0     10      0      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
.I--S--..D-..........G....D....NK.A..R.AV.........      10      0      0      1      0      0      9      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D............AV.Q.......      10      0      0     10      0      0      0      0      10      6  60% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,E619Q,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D..Y........G....DT..SNK....R.AV..S......      10      0      1      8      0      0      0      1      10      9  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.I--S....D.....T.K...GN..DD...SNKR.SDMKR..........      10      0      0      3      3      0      0      4      10      6  60% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,G446S,N450D,L452M,N460K,S477N,T478K,E484R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S....D...ER.L...VG...SH...SNK..S.QKA..........      10      0      3      0      0      0      0      7      10     10 100% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452Q,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I--S--..D...........G....D...SNKT...R.AV........L      10      0      4      6      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
.....--..D...........G....D...SNKN...R.AV.........      10      0     10      0      0      0      0      0      10      8  80% [H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.....--..D...........G....D...SNKR...R.AV.........      10      0     10      0      0      0      0      0      10     10 100% [H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.I.S.....D-.....-.............SNK..S...AL.........      10      0      0      0     10      0      0      0      10      9  90% [T19I,P25S,K97R,G142D,Y144-,E156G,F157-,R158-,P209L,L212S,D215H,A222V,A243-,L244-,S256L,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,S477N,T478K,E484A,F486L,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N703I,N764K,D796Y,Q954H,N969K] 
.....--..D...........G....D...SNK....R.AV....S....      10      0     10      0      0      0      0      0      10      7  70% [H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 

Download

 

last modified: Mon Aug 1 18:21 2022



GISAID data provided on this website is subject to GISAID's Terms and Conditions
Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health