COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


XSpike

eXplore the Spike protein sequence in the SARS CoV-2 virus

Last update: Sep 18, 2022

Dates of current data

Delta and Omicron Variants
Global
Wuhan reference
Early 2021 Variants color key
Delta Variants color key
Delta Omicron Variants color key

Download

Evaluating 352921 sequences of length 3478
Sampled from 2022-07-20 to 2022-09-10.
Specified Date Range: ['2022-07-20', '2022-09-18']
Highest entropy sites for: Global
  Site Entropy
   346  0.2679
   658  0.1920
   452  0.1850
    76  0.1662
  1020  0.1625
   486  0.1599
    70  0.1587
    69  0.1512
     3  0.1397
   440  0.1264
   493  0.1183
     5  0.0744
   408  0.0744
   704  0.0692
   144  0.0680
   444  0.0670
   417  0.0637
   446  0.0537
   339  0.0535
   147  0.0525
   460  0.0524
   157  0.0486
   152  0.0480
   181  0.0462
   257  0.0436
  1162  0.0418
   210  0.0413
   289  0.0357
   547  0.0326
    24  0.0307
    27  0.0295
  1263  0.0292
   701  0.0271
    26  0.0257
   142  0.0256
   146  0.0243
   445  0.0235
    19  0.0233
   681  0.0216
   248  0.0207
   259  0.0201
   450  0.0198
   255  0.0197
  1264  0.0196
   484  0.0195
   371  0.0186
   153  0.0180
   574  0.0169
   213  0.0168
   478  0.0165


Most highly correlated site-pairs for: Global
               cramerV  mutInfo
    70     69   0.5772   0.1452
   486     70   0.4283   0.1310
   452    486   0.5477   0.1294
   486     69   0.5398   0.1257
   452     70   0.5292   0.1236
   452     69   0.5185   0.1185
   486    493   0.5144   0.1035
   452    493   0.5031   0.1010
    70    493   0.6075   0.0967
    69    493   0.5931   0.0942
   346    658   0.3343   0.0915
   452    704   0.6665   0.0602
   493    704   0.4681   0.0452
    70    704   0.4159   0.0421
   486    704   0.4191   0.0421


    24     26   0.9253   0.0237
    27     26   0.9210   0.0231
    24     27   0.8695   0.0252
   157     19   0.5774   0.0010
   257    210   0.5600   0.0356
   152    210   0.5569   0.0357
   339    257   0.5560   0.0354
   339    152   0.5532   0.0353
   152    257   0.5440   0.0343
   147    152   0.5394   0.0341
   147    257   0.5383   0.0338
   460    257   0.5309   0.0337
   460    152   0.5266   0.0333
   339    157   0.5242   0.0335
   157    210   0.5155   0.0334


Most common patterns for local area, where Local = Global
                                              1111
         11111111222222233344444444444445566770122
  122267744445558114555834701444455678894758002666
35946790624672371038579996187045602084637481140234
VLTLPAHVTGYHKWMFGIVYSGTVGRSRKNKVGNLNTEFQTDNPASAPPV  Global     UK  Eu-UK  NAmer   Asia Africa  SAmer  Ocean   Local  Exact  Pct [Context]
                                                    352921  28394  94504 160393  51751    588   5786  11505  320138 <----------- Totals
..I--S--.D........G.....D.FSNK....R.KAV....H......  214988  15205  57872 101721  32761    274   1133   6022  214988 177443  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.....D.FSNK....R.KAV....H......   11393    218    482  10073    522      0     16     82   11393   9436  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H..S...   10503    423   1893   2141   5936      5      9     96   10503   9127  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK....R.KAV...SH......   10452    772   1001   8246    115     19    126    173   10452   9075  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSNK....R.KAV....H......    8222    490    954   5618    758     41    119    242    8222   6536  79% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSN.....R.KAV....H......    4989      0   2855   1318    260      7    549      0    4989   4111  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....DTFSNK....R.KAV....H......    4608    548   2231   1568    190     21     13     37    4608   3797  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSNK....Q.KA.R...H.L....    3388     71    254   2710    278      1     27     47    3388   2385  70% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.FI--S--.D........G.....D.FSNK....R.KAV....H......    3259    321   1066   1418    385      1     13     55    3259   2670  81% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV...SH......    2820    325    516   1645    162     14     47    111    2820   2354  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......G.....D.FSNK....R.KAV....H......    2583    318    713   1121    327      5     14     85    2583   2110  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.F.NK....R.KAV....H......    1962      0    926    402    173      4    455      2    1962   1611  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....D.FSNK......KA.R...H......    1717     23    231    187   1080      1     14    181    1717    975  56% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--.D........G....ID.FSNK....R.KAV....H......    1522     48    792    617     43      2     11      9    1522   1256  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H...L..    1339    154    358    718     92      2      5     10    1339   1080  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I--S--.D......V.G.....D.FSNK....R.KAV....H......    1006     90    207    663     29      0      7     10    1006    848  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DIFSNK....R.KAV....H......     967     77    613    170     81      5     10     11     967    716  74% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H....Q.     858    186    353    256     50      0      0     13     858    712  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNKR...R.KAV....H......     736     42    175    394    106      0     10      9     736    599  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G...A.D.FSNK....R.KAV....H......     699    115    134    334    109      2      3      2     699    608  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259A,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--..........G.....D.FSN.....R.KAV....H......     679      0    479     57     48      0     95      0     679    578  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV....HS.....     638     26     24    559     22      0      0      7     638    511  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701S,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D..ER.L.VG..S..H.FSNK..S..KKA.....H......     614     23     51    191    258      0      0     91     614    312  50% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV...........     612      0    600      3      3      0      0      6     612    362  59% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV....H.....L     604     54    159    309     73      0      1      8     604    474  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNKT...R.KAV....H......     573     73     67    391     28      4      9      1     573    470  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK.A..R.KAV....H......     564     28    155    333     26      6     11      5     564    427  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D....I...G.....D.FSNK....R.KAV....H......     544     41    167    310     21      0      0      5     544    310  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.F...D.FSNK....R.KAV....H......     539    100    178    189     63      0      7      2     539    435  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNKN...R.KAV....H......     519     77    120    219     68      3      9     23     519    433  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.F.........KAV....H......     505      0      1    504      0      0      0      0     505    300  59% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....DSFSNK....R.KAV....H......     504     26     79    361     18      1      3     16     504    427  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....DTFSNK....R.KAV....H......     480     63     45    346     15     10      1      0     480    394  82% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK...DR.KAV....H......     473     14    372     74     10      1      1      1     473    421  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSTK......KA.R...H......     453     20     42     96    265      1      2     27     453    339  74% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I--S-L.D........G.....D.FSNK....R.KAV....H......     447      0    423     16      6      1      1      0     447    382  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..IFI---.D........G.....D.FSNK....R.KAV....H......     415      0    414      1      0      0      0      0     415    321  77% [T19I,L24F,P25-,P26I,A27-,Y28X,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV.I..H......     399     24    116    151     20      0      2     86     399    350  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D..ER.L.VG..S..H.FSNK..S..KKA...V.H......     396     18     49     91    186      0      0     52     396    268  67% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D......A.G.....D.FSNK....R.KAV....H......     377    173    132     61      9      1      0      1     377    295  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181A,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV.K..H......     342     40     56    160     81      0      1      4     342    285  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H...S..     331     19    120    157     29      0      0      6     331    292  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV.I..H..S...     324     41     37    128    111      0      0      7     324    247  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSNK....M.KA.R...H......     322      6     50     83    167      1      8      7     322    218  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I--S--.D........G.....DSFSNK....R.KAV...SH......     319    108    148     44     14      3      0      2     319    268  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........GN....DTFSNK......KA.R...H......     318     12     54     89    120      0      0     43     318    269  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--.D........G.....D.FS.K....R.KAV....H......     317      0     97     35    182      0      2      1     317    243  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.FSNK...DR.KAV....H......     310      6     18    270     16      0      0      0     310    269  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
...--S--.D........G.....D.FSNK....R.KAV....H......     290      1    227     12     41      6      0      3     290    225  77% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNKM...R.KAV....H......     288     35    122    105     19      1      1      5     288    224  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D.....L..G.....D.FSNK....R.KAV....H......     287     19     79    141     29      1      2     16     287    228  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D.Y......G.....D.FSNK....R.KAV....H......     280     31     36    191     18      0      0      4     280    256  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D..ER.L.VG..S..HTFSNK..S..KKAS....H......     280     10     51    104     91      0      0     24     280    165  58% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
..L--S--.D........G.....D.FSNK....R.KAV....H......     271     26     97    128     13      3      2      2     271    224  82% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV....HV.....     269     15     53    175     25      0      0      1     269    207  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSN.....R.KAV....H......     233      0     32     94     16      1     90      0     233    183  78% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.FSN.....R.KAV....H......     226      0     21    185      4      0     16      0     226    174  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........E.....D.FSNK....R.KAV....H......     209      5     42    152      8      0      0      2     209    174  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK..S.R.KAV....H......     198      8     92     75     15      0      7      1     198    111  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H....L.     198     12     55    101     27      1      0      2     198    162  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAI....H......     187      3     58     68     56      0      1      1     187    164  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486I,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....N.FSNK......KA.R...H......     179      0      0      0    179      0      0      0     179    150  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........GH....D.FSNK....R.KAV....H......     175     19     51     58     21      0      2     24     175    145  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSN.....R.KAV...SH......     175      0     47     95      1      0     32      0     175    149  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSN.....R.KAV....H..S...     174      0     92     19     62      1      0      0     174    141  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I--S--.D........G.....D.F.NK....R.KAV....H..S...     167      0    114      9     43      0      1      0     167    143  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I--S--.D--......G.....D.FSNK....R.KAV....H......     166     23     35     93      7      1      0      7     166    147  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KVV....H......     164     13     60     72     16      0      2      1     164    133  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484V,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....RSKAV....H......     159      9     35    107      8      0      0      0     159    123  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D..SNK....R.KAV....H......     158     16    108      5      6      0     22      1     158    126  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV....H..V...     155      4     57     72     12      0      1      9     155    135  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020V] Omicron_BA.4andBA.5
..I--S--.D...L....G.....DTFSNK....R.KAV...SH......     151    123      6     21      1      0      0      0     151    125  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152L,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK..D.R.KAV....H......     146      9     38     77     17      1      2      2     146    109  74% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--..........G.....D.FSNK....R.KAV....H......     141      0     70     13     15      0     43      0     141    117  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H.L....     135     16     32     69     16      0      1      1     135    106  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.F.NK....R.KAV....H......     134      0     10     32     15      0     77      0     134    117  87% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI--S--ID........G.....D.FSNK....R.KAV....H......     131      0      7    115      8      0      1      0     131     98  74% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK.F..R.KAV....H......     130      7     35     80      5      1      0      2     130    111  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445F,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D......R.G.....D.FSNK....R.KAV....H......     113      2     12     71     20      0      1      7     113     95  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D..ER.L.VG..S..HTFSNK..S..KKA...V.H......     111      4     19     24     43      0      0     21     111     86  77% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI--S--.D........G.....D.FSNK....R.KAV....H..S...     109      6     23     32     48      0      0      0     109     96  88% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSN.....R.KAV....H......     106      0     77     25      1      0      3      0     106     94  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D...L....G.....D.FSNK....R.KAV....H......     102      7     22     60      8      0      0      5     102     74  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID-.......G.....D.FSNK....R.KAV....H......     102      1      7     92      2      0      0      0     102     86  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSN.....R.KAV...SH......      98      0     17     50      5      0     26      0      98     84  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....DKFSNK....R.KAV....H......      90     11     14     61      2      0      0      2      90     76  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV...SHV.....      89      3      0     86      0      0      0      0      89     68  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D......E.G.....D.FSNK....R.KAV...SH......      88      5      0      4      6      0      0     73      88     78  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,Q1201L] Omicron_BA.4andBA.5
..I--S--.D..I.....G.....D.FSNK....R.KAV....H......      88     14     42     24      4      1      2      1      88     74  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D..N.....G.....D.FSNK....R.KAV....H......      86      3     37     43      2      1      0      0      86     73  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......G.....DTFSNK....R.KAV...SH......      86     21      3     61      0      0      0      1      86     67  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I.----.D........G.....D.FSNK....R.KAV....H......      85      3     21     42     15      0      0      4      85     74  87% [T19I,P25-,P26-,A27-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....RIKAV....H......      83     13     48     18      1      0      0      3      83     70  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460I,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D.Q......G.....D.FSNK....R.KAV....H......      81     11     13     50      5      0      0      2      81     65  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Q,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G...I.D.FSNK....R.KAV....H......      79      3     18     51      7      0      0      0      79     70  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTF.NK....R.KAV...SH......      78      0     16     11      0      0     51      0      78     67  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....D.FSN.....Q.KA.R...H.L....      77      0      5     42      2      0     28      0      77     60  77% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F..K....R.KAV....H......      77      0     21     51      5      0      0      0      77     52  67% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....DTFSNK....M.KA.R...H......      75      5     18     21     26      0      0      5      75     65  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I--S--.D-.......G.....D.FSNK....R.KAV....H..S...      75      3     12     33     24      0      0      3      75     71  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--ID........G.....D.F.NK....R.KAV....H......      74      0      5     63      5      0      1      0      74     57  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI--S--.D........G.....DTFSNK....R.KAV...SH......      73      3      3     62      0      0      1      4      73     64  87% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI--S...D........G.....D.FSNK....Q.KA.R...H.L....      72      1     11     53      4      0      0      3      72     42  58% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.FI--S--.D........G.....D.FSN.....R.KAV....H......      71      0     40     21      3      0      7      0      71     61  85% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....D.FSNK....R.KAV....H......      71      0      8     49     12      0      0      2      71     31  43% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSNK....Q.KA.R...H.L...L      70      2      3     63      1      0      0      1      70     59  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S...D........G.....D.F.NK....Q.KA.R...H.L....      70      0      6     28      5      0     31      0      70     52  74% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....Y.FSNK....R.KAV....H......      69      3     10     35     16      0      0      5      69     45  65% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339Y,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I--S--.D........G.....DIFSNK....R.KAV....H......      68      1      1     62      0      1      0      3      68     57  83% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D.-......G.....D.FSNK....R.KAV....H......      67      3     32     21      9      0      0      2      67     56  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNKT...RKKAV....H......      67      9     17     39      1      0      0      1      67     46  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G..D..D.FSNK....R.KAV....H......      66      3     11     37     10      1      1      3      66     54  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......G.....DTFSNK....R.KAV....H......      66      3     33     23      5      0      0      2      66     54  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.RAV....H......      64      1     34     24      3      0      0      2      64     55  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478R,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.F.........KAV....H......      64      0      0     64      0      0      0      0      64     37  57% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D.....L..G.....D.FSNK......KA.R...H......      63      0      2      3     58      0      0      0      63     46  73% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--.D...R....G.....D.FSNK....R.KAV....H......      63      3     25     30      4      1      0      0      63     57  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D...NK....R.KAV....H......      62      0     62      0      0      0      0      0      62     27  43% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KSV....H......      61      8     28     19      4      0      0      2      61     48  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484S,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G....ID.FSN.....R.KAV....H......      59      0     52      5      1      0      1      0      59     45  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D..E.....G.....D.FSNK....R.KAV....H......      56      0     23     31      1      0      0      1      56     40  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK..V.R.KAV....H......      55      6     17     28      3      0      1      0      55     46  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446V,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D..T.....G.....D.FSNK....R.KAV....H......      55      2     47      4      2      0      0      0      55     52  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D..............D.F.NK....R.KAV....H......      55      0      2      2     50      1      0      0      55     22  40% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,S371F,S373P,T376X,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D-.......G.....D.FSN.....R.KAV....H......      53      0     27     11      6      0      9      0      53     44  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F..........AV....H......      53      0      0     53      0      0      0      0      53     15  28% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....DTFSNK......KA.R...H......      52      4     15     11     12      0      1      9      52     24  46% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--.D........G.....D.F.......R.KAV....H......      52      0      1     51      0      0      0      0      52     41  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D-.......G.....D.FSNKT...R.KAV....H......      49      0     43      3      3      0      0      0      49     40  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........GS....D.FSTKN.....KA.R...H......      49      1      6     14     25      0      0      3      49     44  89% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S247N,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I--S...D..ER.L.VG..S..HTFSNK..S..KKA.....H......      49      0      7     17     24      0      0      1      49     25  51% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D-...I...G.....D.FSNK....R.KAV....H......      48      8      7     28      5      0      0      0      48     41  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK..S.R.KAV.I..H..S...      47      0      6     13     28      0      0      0      47     42  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV...SH..S...      45      0     43      2      0      0      0      0      45     32  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G261V,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK......KA.R...H......      45      3     16     19      4      0      1      2      45     39  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--.D-.......G.....D.FSTK..S.Q.RA.R...H.....L      45      1      0     26     17      0      0      1      45     39  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,S71F,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,G446S,L452Q,S477N,T478R,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
..I......D..ER.L.VG..S..H.FSNK..S..KKA.....H......      45      0      0      0     45      0      0      0      45     23  51% [T19I,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D...........KAV....H......      45      0      0     45      0      0      0      0      45      9  20% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI--S--.D-.......G.....D.FSNK....R.KAV....H......      43     13      4     26      0      0      0      0      43     36  83% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.....D.FSNKR...R.KAV....H......      43      2      2     39      0      0      0      0      43     37  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....Q.KAV....H......      42      3      8     26      4      0      0      1      42     36  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSN.......KAV....H......      42      0      3     37      1      0      1      0      42     26  61% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D......E.G.....D.FSNK....R.KAV....H......      41      3     18     16      3      0      0      1      41     38  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D....V...G.....D.FSNK....R.KAV....H......      40      1     12     19      8      0      0      0      40     19  47% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K150N,M153V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....RKKAV....H......      40      1      9     29      0      0      0      1      40     33  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....Y......      40      3     12     16      7      0      1      1      40     33  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681Y,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.................KAV....H......      40      0      0     40      0      0      0      0      40     21  52% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.FI--S--.D........G.....DTFSNK....R.KAV....H......      39     10     19      7      0      1      0      2      39     26  66% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D..ER.L.VG..S..H.FSNK..S..KKAS....H......      39      0      2     11     22      0      0      4      39     32  82% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D..N.....G.....D.FSNK....R.KAV....H..S...      38     14     20      0      4      0      0      0      38     34  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....DTF.NK....R.KAV....H......      38      0     28      5      3      0      2      0      38     33  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G..S..D.FSNK....R.KAV....H......      37      1     27      7      2      0      0      0      37     33  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G257S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.....D.FSNK....R.KAV....H...S..      37      0      1     36      0      0      0      0      37     33  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I--S--.D......V.G.F...D.FSNK....R.KAV....H......      34      0     33      1      0      0      0      0      34     32  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.......FSNK....R.KAV....H......      34      2     12     18      2      0      0      0      34     25  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI--S--.D........G....ID.FSNK....R.KAV....H......      33      0     11     18      1      0      0      3      33     18  54% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI--S--.D........G.....D.FSNK....R.KAV...SH......      33      0      5     24      1      0      2      1      33     25  75% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI--S--.D........G.....D.F.NK....R.KAV....H......      33      0     15      3      2      0     13      0      33     28  84% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....RYKAV....H......      33      3     11     15      3      0      0      1      33     28  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460Y,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....H....S.      33      5      5     14      9      0      0      0      33     27  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263S] Omicron_BA.4andBA.5
..I--S--.D......V.G.....D.FSN.....R.KAV....H......      33      0     19      5      0      0      9      0      33     30  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAA....H......      32      6      9     14      3      0      0      0      32     27  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D..E.....G.....DTFSNK....R.KAV...SH......      31      0      3     27      0      1      0      0      31     28  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DIFSN.....R.KAV....H......      31      0     29      0      2      0      0      0      31     26  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R........H......      31      0      1     20     10      0      0      0      31      8  25% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I......D..ER.L.VG..S..H.FSNK..S..KKA...V.H......      31      0      0      0     31      0      0      0      31     14  45% [T19I,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D574V,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KA.....H......      30      3     12      9      5      0      0      1      30     21  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSN.....R.KAV....H...L..      30      0     22      7      0      0      1      0      30     17  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] 
..I--S...D........GH....D.FSNK....Q.KA.R...H.L....      30      1      1     28      0      0      0      0      30     20  66% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--.D........G.....D.F................H......      30      0      0     30      0      0      0      0      30      6  20% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I--S--.D........G.F...D.FSNK....R.KAV....H..S...      29      0     13      8      8      0      0      0      29     28  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D.......TG.....D.FSNK....R.KAV....H......      29      5     10     13      1      0      0      0      29     22  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,I210T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--ST-.D........G.....D.FSNK....R.KAV....H......      29      0     11     16      1      0      1      0      29     27  93% [T19I,L24-,P25-,P26-,A27S,I68-,H69T,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D-.......G.....D.FSNK....R.KAV....H......      28      2      1     24      1      0      0      0      28     26  92% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK.A..R.KAV....H......      28      0      3     24      1      0      0      0      28     27  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI--S...D........G.....D.FSNK......KA.R...H......      27      0      2      1     18      0      0      6      27     13  48% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--.--.D........G.....D.FSNK....R.KAV....H......      27      0     20      7      0      0      0      0      27     14  51% [T19I,L24-,P25-,P26-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........GN....D.FSNK......KA.R...H......      26      1     12     11      2      0      0      0      26     13  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,+247SGE,Y248N,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--..........G.....D.FSN.....R.KAV....H..S...      26      0     22      1      2      0      1      0      26     16  61% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
G.I--S--.D......V.G.....D.FSNK....R.KAV....H......      26      0      8      4      0      0      0     14      26     13  50% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I670V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID.....L..G.....D.FSNK....R.KAV....H......      26      0      1     25      0      0      0      0      26     19  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G....LD.FSNK....R.KAV....H......      25      1      7     16      1      0      0      0      25     24  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289L,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.II--S--.D........G.....D.FSNK....R.KAV....H......      25      0     22      3      0      0      0      0      25     21  84% [L5I,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....HT.....      25      1      1     21      2      0      0      0      25     21  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701T,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI--S--.D........G.....D.FSNKR...R.KAV....H......      24      0      1     22      1      0      0      0      24     23  95% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK.A..R.KAV....H..S...      24      1     16      3      4      0      0      0      24     18  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSNK...DR.KAV....H......      24      0      3     20      1      0      0      0      24     22  91% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.F.........KAV....H......      24      0      0     24      0      0      0      0      24     16  66% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D-.......G....ID.FSNK....R.KAV....H......      23      0     23      0      0      0      0      0      23     19  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D..ER.L.VG..S..H.FSNK..S.RKKA.....H......      23      0      5      5     12      0      0      1      23     16  69% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I--S--.D........G.....D.FSNK.A..R.KAV....H......      23      0      1     21      0      0      0      1      23     20  86% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.....D.FSNK....R.KAV....HV.....      23      0      0     23      0      0      0      0      23     17  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSN.......KA.R...H......      22      0      6     12      0      0      4      0      22     11  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--.D........G.....D.FSNK....R.EAV....H......      22      3      4     12      1      0      0      2      22     20  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478E,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D.....L..G.....D.FSNK....Q.KA.R...H.L....      22      0      2     20      0      0      0      0      22     11  50% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--.D........R.....D.FSNK....R.KAV....H......      22      4      2     12      3      0      0      1      22     18  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213R,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..ISH---.D........G.....D.FSNK....R.KAV....H......      22      0     14      5      3      0      0      0      22     15  68% [T19I,L24S,P25-,P26H,A27-,Y28-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D--....E.G.....D.FSNK....R.KAV....H......      22      4      4     14      0      0      0      0      22     20  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,H146-,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....D.F.........KA.R...H.L....      22      0      0     22      0      0      0      0      22     12  54% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV....H..S..L      21      0      1      3     17      0      0      0      21     17  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,V1264L] Omicron_BA.4andBA.5
..I--S--.D-.......G.....D.F.NK....R.KAV....H......      21      0      7      5      4      0      5      0      21     17  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F.NK....R.KAV...SH......      21      0      9      2      1      0      9      0      21     17  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D...R....G.....D.FSNK....R.KAV....H...L..      21      1      0     20      0      0      0      0      21     16  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,W152R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I--S--.D..R.....G.....D.FSNK....R.KAV....H......      20      1      9      9      0      0      0      1      20     14  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSNKR...R.KAV....H......      20      0      1     15      1      0      0      3      20     18  90% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.F...D.FSNK....R.KAV....H......      20      0      0     20      0      0      0      0      20     14  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK....R.KAV...........      20      0     19      1      0      0      0      0      20     14  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
G.I--S--.D........G.....DTFSN.....R.KAV....H......      20      0      2     15      0      0      3      0      20     16  80% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F.N.......KAV....H......      20      0      0     20      0      0      0      0      20     18  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D............AV....H......      20      0      0     20      0      0      0      0      20      6  30% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--..........G.....DTFSN.....R.KAV....H......      20      0     20      0      0      0      0      0      20     16  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNKN...R.KAV....H..S...      19      0      1     15      3      0      0      0      19     17  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--ID........G.....DTFSNK....R.KAV....H......      19      1      4     13      1      0      0      0      19     15  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK......KAV....H......      19      1      1     12      4      0      0      1      19     15  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..V--S--.D........G.....D.FSNK....R.KAV....H......      19      0      6      7      6      0      0      0      19     10  52% [T19V,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.F...D.FSN.....R.KAV....H......      19      0      3      2      1      0     13      0      19     17  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D.L......G.....D.FSNK....R.KAV....H......      19      0      2     16      0      0      0      1      19     19 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSNKT...R.KAV....H......      19      0     15      3      0      1      0      0      19     15  78% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,I1221T] Omicron_BA.4andBA.5
..I--S--.D........G.....D.F.N.....R.KAV....H......      19      0      1     18      0      0      0      0      19     13  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D.Y......G.....DTFSNK....R.KAV...SH......      19      0      0     19      0      0      0      0      19     19 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--..........G........................H......      19      0      0     19      0      0      0      0      19      7  36% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I......D..ER.L.VG..S..HTFSNK..S..KKAS....H......      19      0      0      0     19      0      0      0      19     11  57% [T19I,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,F486S,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,D1199N] 
..I--S...D........G.....D.FSNK......KA.R...H.L....      18      0      2      3      9      0      0      4      18     10  55% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R357K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S...D........GS....D.FSNK......KA.R...H......      18      2      5      9      1      0      0      1      18      4  22% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,E1202Q] Omicron_BA.2
..I--S--.D........G.....D.FSNK....R.KAV..Y.H......      18      1      4      8      4      0      0      1      18     14  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D574Y,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S-L.D........G.....D.FSNK....R.KAV....H..S...      18      0     17      1      0      0      0      0      18     14  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S...D.....S..G.....D.FSNK......KA.R...H......      18      0      9      0      7      0      1      1      18     11  61% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S...D........G.....D.FSNK...D..KA.R...H......      18      0      4      1     13      0      0      0      18      8  44% [T19I,L24-,P25-,P26-,A27S,W64L,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
......--.D-.............DKL.NK..S...KA.RK..H......      18      3      9      4      1      1      0      0      18      5  27% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
..I--S--.D........G.....DTFSNK....R.KAV...SH....S.      18     18      0      0      0      0      0      0      18     17  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263S] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK....R.KAV....H..S...      18      0      2      2     14      0      0      0      18     17  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.-I--S--.D........G.....D.FSNK....R.KAV....H......      18      0     12      4      1      0      1      0      18      8  44% [F4-,L5-,+5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNKT...RKKAV....H......      18      7      2      6      1      0      0      2      18     18 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,N460K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D....T...G.....D.FSNK....R.KAV....H......      17      0      3     10      4      0      0      0      17     12  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....DTFSNKR...R.KAV....H......      17      0      1     16      0      0      0      0      17     15  88% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D-.......G.....D.FSNK....Q.KA.R...H.L....      17      1      0     16      0      0      0      0      17      8  47% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--ID........G.....D.FSNKN...R.KAV....H......      17      0      0     17      0      0      0      0      17     11  64% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK.A..R.KAV...SH......      17      0      0     17      0      0      0      0      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK....R.KAV...SH.....L      17      0      0     16      0      0      0      1      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
..I--S--.D........G.....DIFSNK....R.KAV...........      17      0     16      0      0      0      0      1      17      8  47% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G....ID.FSNK....R.KAV...........      17      0     17      0      0      0      0      0      17     11  64% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK.I..R.KAV....H......      17      3      5      8      1      0      0      0      17     15  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445I,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D......V.G.....DTFSNK....R.KAV...SH......      17      2      5      9      0      0      1      0      17     16  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSN.....R.KAV....H....Q.      17      0     15      1      1      0      0      0      17     17 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] 
..I--S--.D........G........................H......      17      0      0     17      0      0      0      0      17      6  35% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.F...D.FSNK.A..R.KAV....H......      17      0      0     16      1      0      0      0      17     10  58% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y145H,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KPV....H......      16      1      2      5      8      0      0      0      16     11  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484P,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV..N.H......      16      3      6      7      0      0      0      0      16      9  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D574N,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--..........G.....D.FSN.....R.KAV....H......      16      0      6      5      1      0      4      0      16     15  93% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....DTFSNK....R.KAV....H....Q.      16      4      3      9      0      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
...--S...D..ER.L.VG..S..H.FSNK..S..KKA.....H......      16      0      0      0     16      0      0      0      16     14  87% [L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D..Q.....G.....D.FSNK....R.KAV....H......      16      0     10      1      5      0      0      0      16     14  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147Q,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....Q.KA.R...H.L....      16      0      3      8      3      0      0      2      16     14  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--.D........G.....D.FS.K....R.KAV....H..S...      16      0      1      1     14      0      0      0      16     10  62% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I--S--.D........GS....D.FSNK....R.KAV....H......      16      0     10      0      2      0      0      4      16      6  37% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D..............D.FSNK....R.KAV....H......      16      0      5      6      4      1      0      0      16     10  62% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.F...D.FSNK....Q.KA.R...H.L....      16      0      0     15      0      0      1      0      16      9  56% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--ID........G.....D.FSNK.A..R.KAV....H......      16      0      0     16      0      0      0      0      16     10  62% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,T883I,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID.-......G.....D.FSNK....R.KAV....H......      16      1      0     15      0      0      0      0      16      9  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G75D,T76I,G142D,H146-,V213G,T250P,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....D.F.........KAV....H......      16      0      0     16      0      0      0      0      16      8  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D-.......G.....D.FSNK...DR.KAV....H......      16      1      8      3      2      0      0      2      16     14  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.F..K......KAV....H......      16      0      0     16      0      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..IFI---.D........G.....DSFSNK....R.KAV....H......      16      0     16      0      0      0      0      0      16     14  87% [T19I,L24F,P25-,P26I,A27-,Y28X,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I...--.D........G.....D.FSNK....R.KAV....H......      15      0      4      4      2      0      0      5      15      7  46% [T19I,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......G.....D.FSNK....R.KAV....H...L..      15      4      4      5      1      0      1      0      15     13  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
...--S--.D........G.....D.FSNK....R.KAV...........      15      0      4      0     11      0      0      0      15     13  86% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNKR...R.KAV....H..S...      15      1      2      5      7      0      0      0      15     15 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....DIF.NK....R.KAV....H......      15      0     12      0      2      0      1      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S-L.D........G.....DTFSNK....R.KAV....H......      15      0     15      0      0      0      0      0      15     13  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--..........G.....DTFSN.....R.KAV...SH......      15      0      8      3      0      0      4      0      15     13  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D-Q......E.....HTFSNK.PS...KA.R...H......      15      1      3      1     10      0      0      0      15      8  53% [T19I,L24-,P25-,P26-,A27S,V83A,G142D,Y144-,H146Q,Q183E,V213E,G339H,R346T,L368I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445P,G446S,S477N,T478K,V483A,E484A,F490V,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,G798D,Q954H,N969K,S1003I] 
..I--S--.D........G.....D.FSNK....R.KAV....H..SL..      15      0     13      0      2      0      0      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,P1162L] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK....R.KAV.I.SH......      15      0      2     13      0      0      0      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.....D.FSNK....R.KAV....H.L....      15      0      0     15      0      0      0      0      15     13  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....DTF.........KAV...SH......      15      0      0     15      0      0      0      0      15      6  40% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D-.......G.....D.FSNK.A..R.KAV....H......      15      2      0      7      4      0      0      2      15     11  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,V445A,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D........G.....DTFSNK....Q.KA.R...H.L....      15      1      0     14      0      0      0      0      15     13  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S...D....T...G..D..D.FSNKR..DMKKR.....H......      15      0      3      3      6      0      0      3      15     14  93% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,N164K,V213G,H245N,G257D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,N450D,L452M,N460K,S477N,T478K,E484R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KTV....H......      14      1      3      6      4      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484T,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....D.YSNK......KA.R...H......      14      0      5      1      8      0      0      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371Y,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
......--.D..E.....G.....DKFSNK.....KKA.....H......      14      1     12      0      1      0      0      0      14     11  78% [H69-,V70-,G142D,K147E,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,H1101Y] 
..I--S...D--......G.....D.FSNK....Q.KA.R...H.L....      14      0      2     12      0      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,H146-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S...D........G.....D.FSNK....Q.KA.....H.L....      14      0      0     14      0      0      0      0      14      8  57% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I--S...D........GS....D.FSTKN...R.KA.R...H......      14      0      0      0     14      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S247N,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,L452R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I--S...D........G.....D.FSNK....Q.KA.R...H.....L      14      3     11      0      0      0      0      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
..I--S--.D..N.I...G.....D.FSNK....R.KAV....H......      14      1     11      1      1      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,E1258Q] Omicron_BA.4andBA.5
..I--S--ID........G.....DSFSNK....R.KAV....H......      14      0      0     14      0      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.F.........KAV...SH......      14      0      0     14      0      0      0      0      14      6  42% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.FSNK..S.R.KAV....H......      14      0      0     14      0      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID-.......G.....D.FSNK...DR.KAV....H......      14      0      0     14      0      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D.......-G.....D.FSNK....R.KAV....H......      13      0      6      2      5      0      0      0      13      9  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,I210-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..ISH---ID........G.....D.FSNK....R.KAV....H......      13      0      0     13      0      0      0      0      13     13 100% [T19I,L24S,P25-,P26H,A27-,Y28-,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSNK....R.KAV....H....L.      13      1      3      2      3      0      1      3      13     13 100% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSNK....Q.KA.R...H.L.L..      13      0      7      6      0      0      0      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--I.........G.....D.FSN.....R.KAV....H......      13      0      4      7      0      0      2      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D......R.G.....D.FSNK....R.KAV....H..S...      13      0      0     13      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.FI--S...D........G.....DTFSNK......KA.R...H......      13      0      0      0      0      0      0     13      13     13 100% [L5F,T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I--S--ID........G.....D.FSNK....R.KAV....H...L..      13      0      0     12      1      0      0      0      13      7  53% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I--S--.D........G.F...D.FSNK....R.KAV...SH......      13      0      0     13      0      0      0      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R..AV...........      13      0     13      0      0      0      0      0      13      5  38% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F.NK....R.KAV...........      13      0     13      0      0      0      0      0      13      8  61% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.FSNK....R.KAV.K..H......      13      0      0     13      0      0      0      0      13     10  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D..-.....G.....D.FSNK....R.KAV....H......      13      1      9      2      0      0      0      1      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147-,N148-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....V.FSNK....R.KAV....H......      13      1     12      0      0      0      0      0      13     11  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339V,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D..R.....G..S..DTFSNK....R.KAV....H......      13     13      0      0      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147R,V213G,G257S,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I......D........G.....D.FSNK....R.KAV....H......      13      0      0      0     13      0      0      0      13     10  76% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI--S--.D........G.....DIFSNK....R.KAV....H......      12      0      9      3      0      0      0      0      12     12 100% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.IAV....H......      12      0      4      8      0      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478I,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV...SH.L....      12      5      0      6      0      0      0      1      12      7  58% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,D1163V] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSNKN...Q.KA.R...H.L....      12      0      0     12      0      0      0      0      12      6  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S--.D-.......G.....DSFSNK....R.KAV....H......      12      0      2     10      0      0      0      0      12     12 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FS........KAV....H......      12      0      0     12      0      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I--S--.D........G.....D.FSNK....R.KAV....H.L....      12      0      0     12      0      0      0      0      12     11  91% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSN.......KAV...........      12      0     12      0      0      0      0      0      12      9  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK......KAV...........      12      0     12      0      0      0      0      0      12      8  66% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--ID......V.G.....D.FSNK....R.KAV....H......      12      0      3      9      0      0      0      0      12      9  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSN.....R.KAV....HS.....      12      0      3      9      0      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701S,N764K,D796Y,Q954H,N969K] 
..I......D........G.....D.FSTK..S.Q.RA.R...H.....L      12      0      0      0     12      0      0      0      12      8  66% [T19I,S71F,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,G446S,L452Q,S477N,T478R,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
..I--S--.D........G.....D..................H......      12      0      0     12      0      0      0      0      12      4  33% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....D.FST.......KA.R...H......      11      0      7      2      2      0      0      0      11      5  45% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D.Y......G.....D.FSNK....R.KAV....H..S...      11      1      3      4      3      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146Y,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
......--.D-.............D.L.NK..S...KA.RK..H......      11      1      7      2      1      0      0      0      11      3  27% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
..I--S...D........GS....D.FSNK...D..KA.R...H......      11      3      2      1      5      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
G.I--S-L.D........G.....D.FSNK....R.KAV....H......      11      0      9      1      0      1      0      0      11      9  81% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D.....S..G.....D.FSTKN.....KA.R...H......      11      0      0      2      7      0      0      2      11      8  72% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,L244F,H245-,A264S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I--S--.D........G..V..D.FSNK....R.KAV....H......      11      2      4      3      0      0      0      2      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G257V,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV....R......      11      1      4      6      0      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681R,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNK....R.KAV....H..S.L.      11      0      3      0      8      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,P1263L] Omicron_BA.4andBA.5
G.I--S--.D........G.F...D.FSNK....R.KAV....H......      11      1      2      6      1      0      1      0      11      9  81% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.F...D.FSNK...DR.KAV....H......      11      0      0     11      0      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
A.I--S--.D........G.....D.FSNK....R.KAV....H......      11      1      0      8      1      0      0      1      11     10  90% [V3A,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--ID........G.....D.FSNK....R.RAV....H......      11      0      0     11      0      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478R,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F...........V....H......      11      0      0     11      0      0      0      0      11      4  36% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D.....S..G.....D.FSNK....R.KAV....H......      11      0      7      2      2      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...--.......G.....D.FSNK..S...KAP....H......      11      5      1      3      2      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,W64R,L141-,G142-,V143-,Y144-,V213G,A243-,L244-,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,S477N,T478K,E484A,F486P,S494P,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1143L] 
..I--S--.D........G.F...D.F.NK....R.KAV....H......      11      0      9      1      0      0      1      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.FSNKN...R.KAV.K..H......      11      0      0      3      8      0      0      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......G.....D.FSNK....R.KAV.I..H..S...      11      0      0      4      7      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S...D........G.....D.FSN.....M.KA.R...H......      11      0      0      1      2      0      8      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
.FI--S--.D........G...A.D.FSNK....R.KAV....H......      11      0      2      9      0      0      0      0      11     11 100% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259A,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--..........G....ID.FSN.....R.KAV....H......      11      0     11      0      0      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....D.F.NKR...R.KAV....H......      11      0      4      6      0      0      1      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..R......D.....-..................R.K......R......      10      2      7      1      0      0      0      0      10      2  20% [T19R,T95I,G142D,E156G,F157-,R158-,P384L,L452R,T478K,D614G,A653V,P681R,D950N] Delta
..I--S--.D.P......G.....D.FSNK....R.KAV....H......      10     10      0      0      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146P,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......G...I.D.FSNK....R.KAV....H......      10      0      1      8      1      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,T259I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D.-......G.....DTFSNK....R.KAV...SH......      10      1      0      9      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,H146-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D........G.....D.FSNK....R.KAV...DH......      10      0      0      4      6      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658D,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S...D-....S..G.....D.FSTKN.....KA.R...H......      10      1      0      2      7      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I--S--.D........G.....D.FSNK....R.KAV....HV.S...      10      1      8      1      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........G.....DTFSNK....RSKAV...SH......      10      0      5      5      0      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I--S--.D........G.....D.FSNK....R.KAV....H...S..      10      0      4      5      1      0      0      0      10      8  80% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I--S--.D........G...A.D.FSN.....R.KAV....H......      10      0      5      4      0      0      1      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259A,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S...D........G.....D.FSNK....Q.KA.R...H.L..L.      10      0      0     10      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I--S...D..ER.L.VG..S..H.F.NK..S..KKA.....H......      10      0      0      1      9      0      0      0      10      5  50% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.FSNK....R.KAV....H....L.      10      0      1      9      0      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
..I.----.D........G.....D.FSNK....R.KAV....H..S...      10      0      1      4      4      0      0      1      10      5  50% [T19I,P25-,P26-,A27-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I--S--.D........W.....D.FSNK....R.KAV....H......      10      2      2      5      1      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213W,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI--S...D........G.....D.FSTK......KA.R...H......      10      0      0      2      8      0      0      0      10      9  90% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I--S--.D-.......G.F...D.FSNK....R.KAV....H......      10      6      3      1      0      0      0      0      10      7  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I--S--.D-.......E.....D.FSNK....R.KAV....H......      10      0      3      3      4      0      0      0      10      7  70% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..L--S--ID........G.....D.FSNK....R.KAV....H......      10      0      1      8      1      0      0      0      10      9  90% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I--S--.D........G.....D.FSNK....R.KAV...........      10      0     10      0      0      0      0      0      10      4  40% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I--S--.D........G.....DSFSNK....R.KAV...SH...L..      10     10      0      0      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I--S--.D.....L..G.....D.F.NK....R.KAV....H......      10      0     10      0      0      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--S--ID........G.....D.F..........AV....H......      10      0      0     10      0      0      0      0      10      3  30% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.FR......D-....-........D.FSNK..D..KKA.....H......      10      0     10      0      0      0      0      0      10      6  60% [L5F,T19R,P25L,G142D,V143-,Y144-,Y145D,E156G,F157-,R158-,N211-,L212I,D215Y,A243-,L244-,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,N460K,S477N,T478K,E484A,S494P,Q498R,N501Y,Y505H,D614G,H655Y,P681H,N764K,D796Y,Q954H,N969K] 

Download

 

last modified: Mon Aug 1 18:21 2022



GISAID data provided on this website is subject to GISAID's Terms and Conditions
Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health