COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


XSpike

eXplore the Spike protein sequence in the SARS CoV-2 virus

Last update: Aug 9, 2022

Dates of current data

Delta and Omicron Variants
Global
Wuhan reference
Early 2021 Variants color key
Delta Variants color key
Delta Omicron Variants color key

Download

Evaluating 468103 sequences of length 3346
Sampled from 2022-06-10 to 2022-08-02.
Specified Date Range: ['2022-06-10', '2022-08-09']
Highest entropy sites for: Global
  Site Entropy
   452  0.7649
    70  0.5725
   486  0.5606
    69  0.5589
   493  0.5523
   704  0.3772
     3  0.2310
    76  0.1843
   658  0.1677
   440  0.1429
   346  0.1365
   417  0.1159
   408  0.1084
  1020  0.1023
     5  0.0700
   164  0.0609
   248  0.0563
   339  0.0491
  1162  0.0475
   371  0.0406
   144  0.0390
   405  0.0375
   289  0.0341
    68  0.0337
   181  0.0336
   764  0.0333
   444  0.0303
   677  0.0291
    19  0.0281
   157  0.0279
   142  0.0266
   376  0.0253
   547  0.0247
   701  0.0246
  1264  0.0239
   375  0.0239
    64  0.0238
   147  0.0203
   373  0.0198
   681  0.0197
  1263  0.0192
   446  0.0187
   153  0.0187
   259  0.0185
   460  0.0184
   255  0.0183
    27  0.0183
    24  0.0179
   670  0.0176
   213  0.0165


Most highly correlated site-pairs for: Global
               cramerV  mutInfo
    70     69   0.5000   0.5580
   486    493   0.7016   0.5379
    70    486   0.4027   0.5293
   452    486   0.4906   0.5230
   486     69   0.4917   0.5229
    70    493   0.6949   0.5197
   452    493   0.6907   0.5155
    69    493   0.6928   0.5143
   452     70   0.4862   0.5108
   452     69   0.4849   0.5049
   452    704   0.5653   0.3533
    70    704   0.3831   0.2046
   493    704   0.4703   0.2038
   486    704   0.3820   0.2037
    69    704   0.3821   0.2036


   375    373   0.8750   0.0161
   376    373   0.8305   0.0155
   376    375   0.7635   0.0174
    27     24   0.7218   0.0145
   371    373   0.7143   0.0145
   339    373   0.7043   0.0095
   417    405   0.6724   0.0241
   405    376   0.6279   0.0141
   371    405   0.5878   0.0147
   405    373   0.5783   0.0114
    69     68   0.5716   0.0069
   405    375   0.5533   0.0113
   405    764   0.5489   0.0130
   764    373   0.5360   0.0094
   408    405   0.5012   0.0227


Most common patterns for local area, where Local = Global
                                              1111
          1111111222223333334444444444566667770122
  122666774445568145583477770014445689457780062666
35947489062473741385999613565870462063780711440234
VLTLAWIHVTGYKMFNGVYSTVGRSSSTDRKNKGLNFQTNIQPASNAPPV  Global     UK  Eu-UK  NAmer   Asia Africa  SAmer  Ocean   Local  Exact  Pct [Context]
                                                    468103  61780 125513 195655  57082   2027  13052  12995  422158 <----------- Totals
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K....  212885  32199  71802  79679  20530    780   2499   5396  212885 182153  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK..Q..R....H.LK....   43780   1882   2868  37183   1274     21    210    342   43780  37696  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK.....R....H..K....   25315   1460   5356   5602  10000    188    556   2153   25315  18124  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
G.I-S..--.D......G....D.FPFANSNK..R.V.....H..K....   21995   2777   2773  13228   2164    155    400    499   21995  18782  85% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID......G....D.FPFANSNK..R.V.....H..K....   18295    550    683  16321    576      5     45    115   18295  15444  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V..S..H..K....    8817   2212   1656   3578    636     66    447    222    8817   7457  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....H..KS...    7684    441   1358   1204   4617      6      4     54    7684   6891  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSN...R.V.....H..K....    5011      0   2953   1011    354      3    690      0    5011   4234  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....DTFPFANSNK..R.V..S..H..K....    4849    737    477   3432     59      9     51     84    4849   4329  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D....K.G....D.FPFANSNK..Q..R....H.LK....    4317    202    236   3775     76      0     16     12    4317   3807  88% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSTK.....R....H..K....    3020    447    578    896    957      6     47     89    3020   2400  79% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
.FI-S..--.D......G....D.FPFANSNK..R.V.....H..K....    2937    628   1053    948    222     10     39     37    2937   2496  84% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK..M..R....H..K....    2877    148    903    883    685     26    192     40    2877   1985  68% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S..--.D......G....D.FPFAN.NK..R.V.....H..K....    2394      0    680    209    669      5    831      0    2394   2003  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K.L..    2189    667    636    765    102      3      7      9    2189   1819  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I-S..--.D......G...ID.FPFANSNK..R.V.....H..K....    1902    107   1317    434     32      3      0      9    1902   1660  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D-.....G....D.FPFANSNK..R.V.....H..K....    1577    494    394    505    135      9     11     29    1577   1253  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....N.FPFANSNK.....R....H..K....    1472      0      5      0   1467      0      0      0    1472   1301  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK.....R...EH..K....    1434      0      0      1   1433      0      0      0    1434   1203  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,Q677E,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.T...D......G....D.FPFANSNK.....R....H..K....    1273    129    454    208    137     14     21    310    1273    992  77% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....DTFPFANSNK..R.V.....H..K....    1208    258    626    247     54      7     12      4    1208   1066  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......GN...DTFPFANSNK.....R....H..K....    1164     86     57    253    711      2      0     55    1164    986  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-SR....D......G....D.FPFANSNK.....R....H..K....     917     50    453    112    238      4     26     34     917    774  84% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFAN.NK..Q..R....H.LK....     901      1     43    204     88      0    565      0     901    747  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNK..R.V...V.H..K....     871    111    240    461     29      5      0     25     871    748  85% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I670V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G..A.D.FPFANSNK..R.V.....H..K....     838    356    118    329     24      2      4      5     838    726  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259A,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....HS.K....     750     14     38    683     12      0      0      3     750    593  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701S,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..-L.D......G....D.FPFANSNK..R.V.....H..K....     742      0    729     10      1      1      1      0     742    643  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--........G....D.FPFANSN...R.V.....H..K....     709      0    401    115    109      2     82      0     709    633  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......GS...D.FPFANSNK.....R....H..K....     692     59    201    342     68      0      9     13     692    271  39% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSN......R....H..K....     683      0    351    123     54      1    154      0     683    454  66% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D.....VG....D.FPFANSNK..R.V.....H..K....     644     94    131    388     13      0     16      2     644    587  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D..I...G....D.FPFANSNK..R.V.....H..K....     639    106    213    294     21      2      1      2     639    357  55% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSN...Q..R....H.LK....     633      0    130    381     24      0     98      0     633    536  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK.....R....H..K....     610     81    164    235     95      0     12     23     610    516  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.FI-S.....D......G....D.FPFANSNK..Q..R....H.LK....     597     29     50    491     21      0      5      1     597    504  84% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K..Q.     566    276    195     70     19      0      0      6     566    461  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK..Q..R....H.LK...L     507     13     37    444      6      1      2      4     507    473  93% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D.....AG....D.FPFANSNK..R.V.....H..K....     505    351    107     33      9      0      2      3     505    441  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181A,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I-S..--.D......G....D.FPFANSN...R.V.....H..K....     500      0    123    161     49      2    165      0     500    419  83% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
...-S..--.D......G....D.FPFANSNK..R.V.....H..K....     482      1    251      3    227      0      0      0     482    425  88% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V........K....     462      0    457      1      3      0      0      1     462    246  53% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....DIFPFANSNK..R.V.....H..K....     450     40    338     34     25      1      8      4     450    368  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G.F..D.FPFANSNK..R.V.....H..K....     429    195    119     73     32      2      7      1     429    370  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFAN.......V.....H..K....     421      0      1    417      0      0      3      0     421    372  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFAN.NK..R.V.....H..K....     420      0     19     57    133      0    211      0     420    340  80% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI-S.....D......G....D.FPFANSNK.....R....H..K....     381     19     87    100    147      0     13     15     381    286  75% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFAN........R....H.LK....     381      0      0    381      0      0      0      0     381    314  82% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S.....D...L..G....D.FPFANSNK.....R....H..K....     374     28     39     16    283      2      2      4     374    325  86% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D..PFANSNK..R.V.....H..K....     365     27    216     52     10      0     60      0     365    292  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK.....R....H.LK....     362      6     55     77     66      0      7    151     362    184  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R357K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--ID......G....D.FPFANSN...R.V.....H..K....     351      0     29    312      3      0      7      0     351    304  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....DTFPFANSNK.....R....H..K....     346     36    171     67     61      1      4      6     346    279  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K...L     341     54     91    133     58      0      2      3     341    313  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V..S..HV.K....     336     33      9    287      6      0      0      1     336    276  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.I...H..K....     334     40     86     90     17      0      3     98     334    305  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSN...R.V..S..H..K....     326      0     93     54     10      3    166      0     326    289  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.NK.....R....H..K....     316      0     41     20     79      0    176      0     316    210  66% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFAN.NK..R.V.....H..KS...     311      0     77      4    229      0      1      0     311    260  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I-S..--.D......G....D.FPFA........V.....H..K....     305      0      0    305      0      0      0      0     305    272  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......GN...D.FPFANSNK.....R....H..K....     293      7    126    125     23      4      2      6     293    181  61% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,+247SGE,Y248N,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNKN.R.V.....H..K....     284     32     93    111     31      7      5      5     284    237  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....DSFPFANSNK..R.V..S..H..K....     278    135     85     32     10     12      0      4     278    255  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....DTFPFANSNK..M..R....H..K....     272     20     68     66     88      0      1     29     272    229  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S.....D.E.L..G....H.FPFANSNK.S.K......H..K....     267     22      8     87    123      0      0     27     267    179  67% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G.F..D.FPFANSNK.....R....H..K....     253      9     26    136     68      2      2     10     253    220  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
G.I-S..--.D......G....DTFPFANSNK..R.V.....H..K....     250     74     24    132      6     11      0      3     250    215  86% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.YPFANSNK.....R....H..K....     224     13    144     17     44      0      0      6     224    147  65% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371Y,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..R..R....H..K....     222     14     98     51     51      0      4      4     222    155  69% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....DSFPFANSNK..R.V.....H..K....     211     10     12    176      6      0      0      7     211    147  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346S,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....HV.K....     200     16     51    128      5      0      0      0     200    176  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D...L..G....D.FPFANSNK..R.V.....H..K....     195     53     42     88      9      0      1      2     195    161  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.I...H..KS...     194      8     27     57     93      2      1      6     194    147  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNKT.R.V.....H..K....     191     26     26    129      5      0      5      0     191    165  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK..R.V.....H..K....     187      3    103     58     17      1      3      2     187    150  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K..L.     185     45     47     66     23      0      1      3     185    163  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
..I-SL....D......G....D.FPFANSNK.....R....H..K....     179      8     39     91     40      0      0      1     179    120  67% [T19I,L24-,P25-,P26-,A27S,W64L,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNKR.R.V.....H..K....     177     17     60     81     14      1      2      2     177    142  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..L-S..--.D......G....D.FPFANSNK..R.V.....H..K....     175     55     56     51      8      1      1      3     175    157  89% [T19L,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......GH...D.FPFANSNK.....R....H..K....     174     26     76     45     21      0      6      0     174     79  45% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNK..R.V.....H.......     174      2     99      3     64      0      6      0     174     76  43% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D-.....G....D.FPFANSNK..Q..R....H.LK....     174      8     13    151      1      0      1      0     174     93  53% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFA.........R....H.LK....     174      0      0    174      0      0      0      0     174    152  87% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V.K...H..K....     174     25     27     74     42      0      2      4     174    144  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI-S..--ID......G....D.FPFANSNK..R.V.....H..K....     173      3      6    154      9      0      0      1     173    155  89% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D.....EG....D.FPFANSNK..R.V..S..H..K....     172     25     15     11     20      0      0    101     172    147  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,Q1201L] Omicron_BA.4andBA.5
..I-S.....D...L..G....D.FPFANSNK..Q..R....H.LK....     167     13     11    140      1      0      1      1     167    128  76% [T19I,L24-,P25-,P26-,A27S,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK..Q..R....H..K...L     162      9    137     10      1      0      4      1     162    142  87% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
..I-S..--.D......E....D.FPFANSNK..R.V.....H..K....     157     31     40     76      7      1      0      2     157    139  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..RSV.....H..K....     150     26     37     81      5      0      0      1     150    139  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.I.....H..K....     150      8     78     35     19      0      9      1     150    139  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486I,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--........G....D.FPFANSNK..R.V.....H..K....     140      0     67     24     28      9     11      1     140    115  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANST......R....H..K....     139      0     61     12     60      1      5      0     139    100  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G.F..D.FPFANSNK..Q..R....H.LK....     138     14      8    113      2      0      0      1     138     93  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G..................V.....H.......     138      0      0    138      0      0      0      0     138     95  68% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFAN.NK..R.V..S..H..K....     134      0     12      8     25      1     88      0     134    120  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSN...M..R....H..K....     134      0     28     10      5      0     91      0     134    109  81% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S..--.D......G....D.FPFA........V.....H.......     133      0      0    133      0      0      0      0     133    120  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..RIV.....H..K....     132     34     88      8      1      0      1      0     132    116  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460I,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID......G....D.FPFAN.NK..R.V.....H..K....     131      0      4     66     16      0     45      0     131    109  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S............G....D.FPFANSN......R....H..K....     124      0     87     19      2      0     16      0     124     91  73% [T19I,L24-,P25-,P26-,A27S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K.S..     123     15     31     66      5      0      0      6     123    116  94% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V....HH..K....     120     34     38     34     10      1      0      3     120    100  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,Q677H,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....H.LK....     117     15     43     49      7      0      0      3     117     96  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSN...R.V.....H..KS...     114      0     45      9     59      0      1      0     114    105  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I-S.....D...S..G....D.FPFANSNK.....R....H..K....     108      7     39     14     37      1      8      2     108     82  75% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANS.K..R.V.....H..K....     108      0     51     35     22      0      0      0     108     92  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D...S..G....D.FPFANSTKN....R....H..K....     108      0      1      4    103      0      0      0     108     81  75% [T19I,L24-,P25-,P26-,A27S,G142D,H146-,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I-S.....D......G...................R....H.......     108      0      0    108      0      0      0      0     108     65  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
...-S..--.D......G....D.FPFANSNK..R.V.I...H..KS...     107      0      0      0    106      0      0      1     107     90  84% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I-S..--.D......G....D.............V.....H.......     107      0      0    107      0      0      0      0     107     84  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
G.I-S..--.D-.....G....D.FPFANSNK..R.V.....H..K....     106     10     11     59     16      0     10      0     106     93  87% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK..Q..R....H..K....     104      5     33     55      7      0      3      1     104     81  77% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK.DR.V.....H..K....      98     48     29     16      3      0      2      0      98     78  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446D,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....H..KV...      96     11     40     22      6      0      0     17      96     86  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020V] Omicron_BA.4andBA.5
..I-S.....D-...K.G....D.FPFANSNK..Q..R....H.LK....      96     15      3     76      2      0      0      0      96     84  87% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D..PFANSNK.....R....H..K....      93      8     15     34      3      0     33      0      93     51  54% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....DIFPFANSNK..R.V.....H..K....      93      1      8     80      0      0      0      4      93     71  76% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI-S..--.D......G....D.FPFANSN...R.V.....H..K....      93      0     46     11      6      0     30      0      93     54  58% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK.SR.V.....H..K....      91      9     32     41      7      0      2      0      91     79  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......GH...D.FPFANSNK..Q..R....H.LK....      90      3     10     77      0      0      0      0      90     85  94% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK.....R....H..K.S..      89      5     15     56      7      3      1      2      89     71  79% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.2
..I-S..--.D......G..I.D.FPFANSNK..R.V.....H..K....      88      6     14     62      6      0      0      0      88     76  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK.....R....H..K...L      87     10     38     10     11     11      4      3      87     71  81% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.2
..I-S.....D......G....D.FPFA.........R....H.......      86      0      0     86      0      0      0      0      86     67  77% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D......GS...D.FPFANSTKN....R....H..K....      85      0      3     14     62      0      0      6      85     72  84% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S247N,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I-S..--.D......G....D.FPFANSNK..Q..R....H.LK....      83      2      8     67      0      0      6      0      83     77  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......GN...DTFPFANSN......R....H..K....      83      0      5     10     67      0      1      0      83     69  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK.....R.......K....      82      0     78      1      0      0      0      3      82     36  43% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFAN.......V.....H..K....      81      0      0     81      0      0      0      0      81     77  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V..S..H..KS...      78      2     71      5      0      0      0      0      78     62  79% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G261V,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I.-..--.D......G....D.FPFANSNK..R.V.....H..K....      78      7     29     38      2      0      2      0      78     62  79% [T19I,P25-,P26-,A27-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSIK.....R....H..K....      77      2     25     23     25      0      0      2      77     62  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417I,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.T...D......G....D.FPFANSNK.....R....H..K...L      76      3     54     17      2      0      0      0      76     72  94% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.2
..I-S.....D.E....G....D.FPFANSNK.....R....H..K....      76      2      8      7     58      0      1      0      76     31  40% [L8F,T19I,L24-,P25-,P26-,A27S,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N450D,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,G1219V] Omicron_BA.2
..I-S............G....D.FPFANSN...Q..R....H.LK....      76      0     23     39      4      0     10      0      76     72  94% [T19I,L24-,P25-,P26-,A27S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNKM.R.V.....H..K....      75     13     25     22     13      0      2      0      75     63  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444M,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI-S..--.D......G....D.FPFANSNK..R.V..S..H..K....      74      5      8     35      2      0     16      8      74     63  85% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID......G....D.FPFA........V.....H..K....      74      0      0     74      0      0      0      0      74     66  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFANSNK..R.V....HH..K....      73     15      0     58      0      0      0      0      73     65  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,Q677H,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I-S..--.D......G....D.FPFAN.......V.....H..K....      72      0      0     72      0      0      0      0      72     66  91% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
...-S.....D......G....D.FPFANSTK.....R....H..K....      72      0      4      0     68      0      0      0      72     54  75% [L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFAN.....R.V.....H..K....      72      0      0     72      0      0      0      0      72     65  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
...-S.....D......G....D.FPFANSNK.....R....H..K....      71      0     25      1     45      0      0      0      71     52  73% [L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.......--.D-..........DKLPF...NK.S...RK...H..K....      68      5     15     17     24      1      3      3      68     41  60% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,R346K,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1.1
..I-S.....D......G....D.FPFANSNK..Q..R....H.LK.L..      68      1      9     52      6      0      0      0      68     55  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
.FI-S..--.D......G....D.FPFANSNK..R.V.....H..KS...      66      4      4      8     50      0      0      0      66     61  92% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S..--.D......G....DTFPFANSN...R.V..S..H..K....      66      0     11     44      0      0     11      0      66     56  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--ID-.....G....D.FPFANSNK..R.V.....H..K....      65      0      5     58      2      0      0      0      65     57  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D...........D.FPFANSNK.....R....H..K....      64     17      4     38      2      0      1      2      64     41  64% [T19I,L24-,P25-,P26-,A27S,G142D,+212T,+213GGG,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,T1231S] 
..I-S..--.D......G....D.FPFANSN.....V.....H..K....      62      0      1     56      0      0      5      0      62     53  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I.......D.E.L..G....H.FPFANSNK.S.K......H..K....      62      0      0      0     62      0      0      0      62     46  74% [T19I,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.......H..K....      62     10     12     25     13      1      0      1      62     16  25% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G......FPFANSNK..R.V.....H..K....      61      3     42     16      0      0      0      0      61     50  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--........G....D.FPFANSN...R.V..S..H..K....      60      0     21      6      1      0     32      0      60     58  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN........R....H..K....      60      0      0     59      0      0      1      0      60     50  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..Q..R....H.LK.S..      59      1     22     36      0      0      0      0      59     51  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D.I....G....D.FPFANSNK..R.V.....H..K....      58     11     33      8      3      1      0      2      58     56  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK.....RK...H..K....      57      1      7      8     37      0      0      4      57     28  49% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFAN..K..R.V.....H..K....      57      0      6     49      2      0      0      0      57     50  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--I.......G....D.FPFANSN...R.V.....H..K....      57      0      3     49      3      0      2      0      57     52  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI-S.....D......G....N.FPFANSNK.....R....H..K....      57      0      0      0     57      0      0      0      57     36  63% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.....Q..R....H.LK....      56      0      0     56      0      0      0      0      56     45  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......GH...D.FPFANSNK..R.V.....H..K....      56     16      8     18      7      0      1      6      56     46  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFA.........R....H..K....      56      0      0     56      0      0      0      0      56     43  76% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-SR....D......G....D.FPFANSN......R....H..K....      55      0     37      3      5      0     10      0      55     41  74% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK.....R....H..K.L..      55      3     20      8     13      0      1     10      55     40  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2
..I-S..--.D......G....D.FPFAN.......V.....H.......      55      0      0     52      0      0      3      0      55     45  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R..R....H..K....      53      0     12     41      0      0      0      0      53     37  69% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..IS-..--.D......G....D.FPFANSNK..R.V.....H..K....      53     26     17      8      0      0      2      0      53     15  28% [T19I,L24S,P25-,P26H,A27-,Y28-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....DKFPFANSNK..R.V.....H..K....      53      8      9     33      1      1      1      0      53     44  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D..............R....H.......      53      0      0     53      0      0      0      0      53     36  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D.E....G....D.FPFANSNK..Q..R....H.LK....      52      0      3     43      6      0      0      0      52     49  94% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
G.I-S..--.D......G....D.FPFANSNK..R.V..D..H..K....      52      2      5      2     41      0      0      2      52     42  80% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658D,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK.....R...HH..K....      52      0      5     11     35      0      0      1      52     35  67% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,Q677H,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G...ID.FPFANSN...R.V.....H..K....      51      0     45      5      1      0      0      0      51     44  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..........H..K....      51      2     19     11     12      0      3      4      51     19  37% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D....K.G....D.FPFANSN...Q..R....H.LK....      51      0      8     29      0      0     14      0      51     39  76% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D-.I...G....D.FPFANSNK..R.V.....H..K....      51     13      3     34      1      0      0      0      51     45  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....DTFPFANSNK..Q..R....H.LK....      50      4      3     42      1      0      0      0      50     45  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G....D.FPF.NSNK..R.V.....H..K....      49      0      0      0      2      0      0     47      49     38  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.T...D......G....DTFPFANSNK.....R....H..K....      49      4     15      4      9      1      0     16      49     46  93% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.FI-S..--.D......G...ID.FPFANSNK..R.V.....H..K....      49      6     39      3      1      0      0      0      49     33  67% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I-S..--........G....D.FPFANSN...R.V.....H..K....      49      0     19     20      1      0      9      0      49     45  91% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.II-S..--.D......G....D.FPFANSNK..R.V.....H..K....      48      0     48      0      0      0      0      0      48     46  95% [L5I,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......GD...D.FPFANSNK.....R....H..K....      47      2      8     21      3      0     12      1      47     16  34% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,+247SAV,Y248D,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
...-S.....D.E.L..G....H.FPFANSNK.S.K......H..K....      47      0      0      0     47      0      0      0      47     36  76% [L24-,P25-,P26-,A27S,G142D,K147E,W152R,F157L,I210V,V213G,G257S,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.NK..M..R....H..K....      46      0      8      2      7      0     29      0      46     36  78% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSTKN....R....H..K....      46     11      0     23     12      0      0      0      46     21  45% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I-S.....D....H.G....D.FPFANSNK..Q..R....H.LK....      46      1     39      6      0      0      0      0      46     33  71% [T19I,L24-,P25-,P26-,A27S,G142D,N164H,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G....D.FPFAN.N...R.V.....H..K....      46      0      0     42      4      0      0      0      46     41  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V.IS..H..K....      45     25     10      8      2      0      0      0      45     38  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V....RH..K....      45      1     21     23      0      0      0      0      45     42  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,Q677R,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI-S.....D......G....D.FPFANSTK.....R....H..K....      44      4      5     14     20      0      0      1      44     43  97% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I-S.....D......G....D..PFANSNK..Q..R....H.LK....      44      0      7     35      0      0      2      0      44     27  61% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFAN.N.....V.....H..K....      44      0      0     44      0      0      0      0      44     39  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSN......R....H.LK....      43      0      4     39      0      0      0      0      43     36  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D....K.G....D.FPFAN.NK..Q..R....H.LK....      43      0      2     17      4      0     20      0      43     39  90% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNKR.Q..R....H.LK....      43      0      1     40      0      0      2      0      43     41  95% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D.....RG....D.FPFANSNK..R.V.....H..K....      43      2     16     22      3      0      0      0      43     35  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181R,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFAN........R....H.......      43      0      0     43      0      0      0      0      43     37  86% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
.......--.D.E....G....DKFPFANSNK...K......H..K....      42      1     40      1      0      0      0      0      42     37  88% [H69-,V70-,G142D,K147E,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,N460K,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,H1101Y] 
..I-S.....D......G....D.FPFANSNK.....R....H..K..L.      42      3     13     13     11      1      0      1      42     23  54% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK..Q..R....HVLK....      42      3      2     37      0      0      0      0      42     40  95% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK..Q.......H.LK....      42      0      3     39      0      0      0      0      42     23  54% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFA........V.....H..K....      42      0      0     42      0      0      0      0      42     40  95% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK.SR.V.I...H..KS...      41      0      1      7     31      0      0      2      41     36  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S..--.D......G....D..PFA........V.....H.......      41      0      0     41      0      0      0      0      41     36  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..Q..R....H.LK..L.      40      0      7     31      2      0      0      0      40     28  70% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNKN.Q..R....H.LK....      40      0      0     40      0      0      0      0      40     31  77% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D..V...G....D.FPFANSNK..R.V.....H..K....      40      5      6     23      4      0      0      2      40     34  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K150N,M153V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI-S.....D....K.G....D.FPFANSNK..Q..R....H.LK....      39      2      2     35      0      0      0      0      39     37  94% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G....D.FPFANSNK..R.V..S..H.LK....      39     29      2      5      3      0      0      0      39     25  64% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D.E....G....D.FPFANSTKN....R....H..K....      39      0      1      2     36      0      0      0      39     35  89% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,I692L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
.FI-S.....D......G....D.FPFANSNK..M..R....H..K....      37      2     13     17      3      0      2      0      37     25  67% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S.....D......G....D.FPFANSNK.....R....H.......      37      0      3      3     29      0      1      1      37     16  43% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--........G..................V.....H.......      37      0      0     37      0      0      0      0      37     19  51% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.T...D......G....D.FPFANSN......R....H..K....      36      0     28      2      1      0      5      0      36     28  77% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK.SQ..R....H.LK....      36      0      2     20     12      0      2      0      36     34  94% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..R.......D...-...................R.......R.......      35      3      7      8     16      0      0      1      35     15  42% [T19R,G142D,E156G,F157-,R158-,A222V,L452R,T478K,D614G,P681R,D950N] Delta+T95_,A222V
..I-S.....D......GS...D.FPFAN.NK.....R....H..K....      35      0      6      1      4      0     24      0      35     19  54% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,E1202Q] 
.FI-S..--.D......G....D.FPFAN.NK..R.V.....H..K....      35      0      7      0     13      0     15      0      35     32  91% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I--..--.D......G....D.FPFANSNK..R.V.....H..K....      35      1      0     34      0      0      0      0      35     17  48% [T19I,L24-,P25-,A27-,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D.N....G....D.FPFANSNK..R.V.....H..K....      35      3     19     11      1      0      0      1      35     27  77% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I.......D......G....D.FPFANSTK.....R....H..K....      34      0      1      0     33      0      0      0      34     19  55% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
.FI-S..--.D......G....DTFPFANSNK..R.V..S..H..K....      33      3      5     24      0      0      0      1      33     31  93% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D.....EG....D.FPFANSNK..R.V.....H..K....      33      2     18      7      2      0      0      4      33     31  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.FI-S..--.D-.....G....D.FPFANSNK..R.V.....H..K....      33     13      2      7     10      0      0      1      33     32  96% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....DTFPFAN.NK..R.V..S..H..K....      33      0      2      7      1      0     23      0      33     33 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....DTFPFANSTK.....R....H..K....      32      8      6      6     12      0      0      0      32     17  53% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I-S.....D......G....D.FPFAN..K..Q..R....H.LK....      32      0      0     31      1      0      0      0      32     24  75% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-SR....D......G....D.FPFANSNK..Q..R....H.LK....      32      0      2     30      0      0      0      0      32     25  78% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK..Q..R....H.LKS...      32      5      5     22      0      0      0      0      32     21  65% [T19I,L24-,P25-,P26-,A27S,G142D,K150N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.2+L452Q+S704L_BA.2.12.1
G.I-S..-L.D......G....D.FPFANSNK..R.V.....H..K....      32      0     25      7      0      0      0      0      32     28  87% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D..V...G....D.FPFANSNK.....R....H..K....      31      1      3      2     24      0      0      1      31     27  87% [T19I,L24-,P25-,P26-,A27S,G142D,M153V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G..A.D.FPFANSNK..R.V.....H..K.L..      31     30      0      1      0      0      0      0      31     30  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259A,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V..S..R..K....      31      0      0     31      0      0      0      0      31     27  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681R,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK.VR.V.....H..K....      31     10      8      9      4      0      0      0      31     26  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446V,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S............G...................R....H.......      31      0      0     31      0      0      0      0      31     13  41% [T19I,L24-,P25-,P26-,A27S,V213G,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
...-S..--.D......G....D.FPFANSNK.SR.V.I...H..KS...      31      0      0      0     31      0      0      0      31     26  83% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I-S..--ID......G..................V.....H.......      31      0      0     31      0      0      0      0      31     23  74% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.TK.....R....H..K....      30      0      8      8     11      0      3      0      30     25  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNK..R.V.....H..K..L.      30      8      3     11      2      0      1      5      30     29  96% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.4andBA.5
..I-S.....D....K.G....D.FPFAN........R....H.LK....      30      0      0     30      0      0      0      0      30     26  86% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFA........V.....H.......      30      0      0     30      0      0      0      0      30     23  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.....N.NK..R.V.....H..K....      30      0     30      0      0      0      0      0      30     22  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D-.....G....D.FPFANSNK.....R....H..K....      29      2     11      4      3      0      0      9      29     12  41% [T19I,L24-,P25-,P26-,A27S,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D.....VG....D.FPFANSNK..Q..R....H.LK....      29      0      2     26      0      0      0      1      29     20  68% [T19I,L24-,P25-,P26-,A27S,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
G.I-S..--.D.E....G....N.FPFANSNK..R.V.....H..K....      29      2      0     27      0      0      0      0      29     28  96% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D..I...G....D.FPFANSNK.....R....H..K....      28      0      5     10     10      0      1      2      28     22  78% [T19I,L24-,P25-,P26-,A27S,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSTK.....R....H..K....      28      2     11      3     10      1      0      1      28     23  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,S71F,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478R,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....Y.FPFANSNK..R.V.....H..K....      28      9      1     16      1      0      1      0      28     25  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339Y,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..Q..RI...H.LK....      28      2      0     26      0      0      0      0      28     25  89% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D-.....G....D.FPFANSN...R.V.....H..K....      28      0     13      7      3      0      5      0      28     22  78% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D...S..G....N.FPFANSNK.....R....H..K...M      28      0      0      0     28      0      0      0      28     28 100% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264M] 
.FI-S..--.D..I...G....D.FPFANSNK..R.V.....H..K....      27      0     18      9      0      0      0      0      27     17  62% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,E1258Q] Omicron_BA.4andBA.5
..I-S..--.D-.....G....D.FPFANSNK..R.V.....H..KS...      27      1      7      9      8      0      0      2      27     23  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANS.K..Q..R....H.LK....      27      0      2     24      1      0      0      0      27     17  62% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK....V.....H..K....      27      0     10     10      4      0      3      0      27     20  74% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFANSNK..R.V.....H..K.L..      27      6      1     20      0      0      0      0      27     24  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..Q.V.....H..K....      27      1      5      8     12      1      0      0      27     25  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI-S.V--.D......G....D.FPFANSNK..R.V.....H..K....      27      2      2     23      0      0      0      0      27     26  96% [L5F,T19I,L24-,P25-,P26-,A27S,I68V,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..R.V.....H..KS..L      26      0      0      0     26      0      0      0      26     24  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S,V1264L] Omicron_BA.4andBA.5
..I-S.....D......G....N.FPFANSNK.....R....H..K.S..      26      0      0      0     26      0      0      0      26     25  96% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] 
..I-S.....D......G....D.FPFAN.N......R....H.LK....      26      0      0     26      0      0      0      0      26     19  73% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFANSNKR.R.V.....H..K....      26      0      0     26      0      0      0      0      26     25  96% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.............V.....H..K....      26      0      0     26      0      0      0      0      26     23  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.............V.....H.......      26      0      0     26      0      0      0      0      26     20  76% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....D..PFA........V.....H..K....      26      0      0     26      0      0      0      0      26     23  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..ISS.....D......GN...DTFPFANSNK.....R....H..K....      26      0      0      0     26      0      0      0      26     18  69% [T19I,L24S,P25X,P26X,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.K...D......G....D.FPFANSNK.....R....H..K....      25      0     20      3      2      0      0      0      25     22  88% [T19I,L24-,P25-,P26-,A27S,I68K,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......E....D.FPFANSNK.....R....H..K....      25      1      5     14      4      0      0      1      25     17  68% [T19I,L24-,P25-,P26-,A27S,G142D,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..Q..RK...H.LK....      25      0      1     21      3      0      0      0      25     12  48% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S............G....D.FPFANSNK..Q..R....H.LK....      25      0      6     18      0      0      1      0      25     22  88% [T19I,L24-,P25-,P26-,A27S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
.FI-S.T...D......G....D.FPFANSNK.....R....H..K....      24      0      2      3      1      0      1     17      24     23  95% [L5F,T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D.N....G....D.FPFANSNK..R.V.....H..KS...      24      4     14      0      6      0      0      0      24     22  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S.....D.N....G....D.FPFANSNK..Q..R....H.LK....      24      0      1     23      0      0      0      0      24     15  62% [T19I,L24-,P25-,P26-,A27S,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK..Q..R....H.LKV...      24      0      2     21      1      0      0      0      24     21  87% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,A1020V] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G....D.FPFANSNK..R.V.....H..K..S.      24      5      7      8      4      0      0      0      24     21  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263S] Omicron_BA.4andBA.5
..I-S..--.D......G....D..PFANSNK..R.V..S..H..K....      24      0      1      3      0      0     20      0      24     21  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D-.....G....D.FPFANSNK..R.V.....H..K.L..      24     10      9      3      2      0      0      0      24     21  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
.FI-S.....D......GN...DTFPFANSNK.....R....H..K....      24      0      2     10     10      0      0      2      24     20  83% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNK..R.A.....H..K....      24     10      3      8      1      0      1      1      24     20  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSN...R.V.....H..K.L..      24      0     17      4      1      0      2      0      24     20  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] 
..I-S.R...D......G....D.FPFANSNK.....R....H..K....      23      1     20      0      0      0      0      2      23     22  95% [T19I,L24-,P25-,P26-,A27S,I68R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANS.K.....R....H..K....      23      0      3      1     12      0      7      0      23     10  43% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G...I..............V.....H..K....      23      0      0     23      0      0      0      0      23     20  86% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D.E....G....D.FPFANSNK..R.V.....H..K....      23      2      2     18      1      0      0      0      23     21  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.R...D......G....DTFPFANSNK.....R....H..K....      22      5     14      0      3      0      0      0      22     22 100% [T19I,L24-,P25-,P26-,A27S,I68R,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.T...D......GH...D.FPFANSNK.....R....H..K....      22      2     15      3      2      0      0      0      22     13  59% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,T791I,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D....K.G....D.FPFANSNK.....R....H..K....      22      0     14      1      5      2      0      0      22     16  72% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....DIFPFANSN...R.V.....H..K....      22      0     22      0      0      0      0      0      22     12  54% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,L249F,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I.......D......G....DTFPFANSNK..M..R....H..K....      22      0      0      0     22      0      0      0      22     13  59% [T19I,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.T...D......G....D.FPFANSTK.....R....H..K....      22      1     15      0      4      0      0      2      22     17  77% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
..I-S..--ID......G....D.FPFANSNK..R.V.....H..K.S..      22      0      0     22      0      0      0      0      22     21  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I-S..--.D......G.F..D.FPFANSNK..R.V..S..H..K....      22      1      0     21      0      0      0      0      22     20  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID......G.F..D.FPFANSNK..R.V.....H..K....      22      0      0     21      1      0      0      0      22      8  36% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
.......--.D-..........D.LPF...NK.S...RK...H..K....      21      1      9      7      2      0      1      1      21      5  23% [A67V,H69-,V70-,T95I,G142D,V143-,Y144-,Y145-,N211-,L212I,+214EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,N856K,Q954H,N969K,L981F] Omicron_BA.1
..I-S..--.D......G....D.FPFANSNKR.R.V.....H..KS...      21      0      0      0     21      0      0      0      21     20  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S.T...D......G....D.FPFANSNK..Q..R....H.LK....      21      1      5     15      0      0      0      0      21     15  71% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D..............R....H.LK....      21      0      0     21      0      0      0      0      21     10  47% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..M..R....H..K....      21      2      5      0      7      6      1      0      21     18  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S.V--.D......G....D.FPFANSNK..R.V.....H..K....      21      1      2     15      3      0      0      0      21     19  90% [T19I,L24-,P25-,P26-,A27S,I68V,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID......G....D.............V.....H.......      21      0      0     21      0      0      0      0      21     15  71% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
G.I-S..--.D......G....DTFPFANSN...R.V.....H..K....      21      0      0     11      1      9      0      0      21     17  80% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G...ID..PFANSNK..R.V.....H..K....      21     10      9      2      0      0      0      0      21     17  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK.....R....HV.K....      20      0      5      8      7      0      0      0      20     13  65% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D....K.G....D.FPFANSNKN.Q..R....H.LK....      20      0      0     20      0      0      0      0      20     17  85% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK..Q..R......LK....      20      0     20      0      0      0      0      0      20     12  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,S704L,N764K,D796Y,Q954H,N969K] 
.FI-S.....D..T...G....D.FPFANSNK.....R....H..K....      20      0      0     20      0      0      0      0      20     19  95% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D.....EG....D.FPFANSNK.....R....H..K....      20      0      2     18      0      0      0      0      20     14  70% [T19I,L24-,P25-,P26-,A27S,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,A522P,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
...-S.....D......GS...D.FPFANSTKN....R....H..K....      20      0      0      0     20      0      0      0      20     19  95% [L24-,P25-,P26-,A27S,G142D,V213G,S247N,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFANSNK..R.V.....HV.K....      20      0      0     20      0      0      0      0      20     19  95% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I-S..--.D......E....D.FPFANSNK..R.V.....H..K....      20      0      1     19      0      0      0      0      20     14  70% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213E,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G...LD.FPFANSNK..R.V.....H..K....      20      3      6      8      3      0      0      0      20     20 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289L,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S...F.D......G....D.FPFANSNK..Q..R....H.LK....      20      0      0     20      0      0      0      0      20     19  95% [T19I,L24-,P25-,P26-,A27S,V70F,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--........G...ID.FPFANSN...R.V.....H..K....      20      0     17      1      0      0      2      0      20     16  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNK..R.V.....H..K.L..      20      0      0     13      3      0      0      4      20     14  70% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.4andBA.5
..I-S..--.D......G....DTFPFANSN...R.V.....H..K....      20      0     19      1      0      0      0      0      20     18  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G..................V.....H.......      20      0      0     20      0      0      0      0      20     15  75% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I--.V--.D......G....D.FPFANSNK..R.V.....H..K....      20      0      0     20      0      0      0      0      20     18  90% [T19I,L24-,P25-,A27-,I68V,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSN......R....H..K....      19      0     12      4      1      0      2      0      19     17  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-SR....D..T...G....D.FPFANSNK.....R....H..K....      19      0     19      0      0      0      0      0      19     14  73% [T19I,L24-,P25-,P26-,A27S,W64R,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
G.I-S..--.D......G....D.FPFANSNK..R.V........K....      19      0     16      0      2      0      0      1      19     12  63% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V..S.....K....      19      0     19      0      0      0      0      0      19     10  52% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G...ID.FPFANSNK..R.V........K....      19      0     19      0      0      0      0      0      19     11  57% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V.....Y..K....      19      2      3     10      3      0      1      0      19     17  89% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681Y,N764K,D796Y,Q954H,N969K] 
..I....--.D......G....D.FPFANSNK..R.V.....H..K....      19      0      6      5      1      0      0      7      19      6  31% [T19I,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.V...D......G....D.FPFANSNK.....R....H..K....      19      0     11      3      4      0      0      1      19     13  68% [T19I,L24-,P25-,P26-,A27S,I68V,G142D,N211G,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S...A.D......G....D.FPFANSNK.....R....H..K....      19      0      9      4      2      1      0      3      19     11  57% [T19I,L24-,P25-,P26-,A27S,V70A,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
G.I-S..--.D......G....D.FPFANSNKR.R.V.....H..K....      19      1      0     15      1      0      0      2      19     16  84% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFAN..K....V.....H..K....      19      0      0     19      0      0      0      0      19     14  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D.....AG....D.FPFANSNK..Q..R....H.LK....      19      0      0      4     15      0      0      0      19     13  68% [T19I,L24-,P25-,P26-,A27S,G142D,G181A,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPF.NSNK.....R....H..K....      18      0      2      0      1      0      0     15      18     15  83% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D..T...G....D.FPFANSNK.....R....H..K....      18      2      2      2     10      0      1      1      18     14  77% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFAN.NK..R.V........K....      18      0     18      0      0      0      0      0      18     12  66% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFAN..K..R.V.....H..K....      18      0      0     18      0      0      0      0      18     16  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.T...D......GS...D.FPFANSNK.....R....H..K....      18      2      7      9      0      0      0      0      18     18 100% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNK..R.......H..KS...      18      0      0      0     18      0      0      0      18      9  50% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I.......D......GN...DTFPFANSNK.....R....H..K....      18      0      0      0     18      0      0      0      18     13  72% [T19I,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
..I-S..--.D......GH...D.FPFANSNK.....R....H..K....      18      1      4     13      0      0      0      0      18     15  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D.....VG....D.FPFANSNK.....R....H..K....      18      1      7      8      1      0      0      1      18      8  44% [T19I,L24-,P25-,P26-,A27S,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--ID......G....D.FPFAN.....R.V.....H..K....      18      0      0     18      0      0      0      0      18     16  88% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.N...Q..R....H.LK....      18      0      0     18      0      0      0      0      18     17  94% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G.F..D.FPFANSNK..M..R....H..K....      17      0     17      0      0      0      0      0      17     11  64% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,D936Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S.....D......G....D.FPFANSNK.....R....H..K...M      17      0      2      3      2      0     10      0      17     16  94% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264M] Omicron_BA.2
G.I-S..--.D......G....D.FPFANSN.....V.....H..K....      17      0      1     15      1      0      0      0      17     16  94% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S............G....D.FPFANSNK.....R....H..K....      17      0      9      3      1      0      4      0      17     14  82% [T19I,L24-,P25-,P26-,A27S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....DTFPFANSN......R....H..K....      17      0     10      0      4      0      3      0      17     13  76% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.FI-S..--.D......G....D.FPFANSNK..R.V..S..H.LK....      17      1      0     16      0      0      0      0      17     16  94% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..L-S.....D......G....D.FPFANSNK.....R....H..K....      17      1      2      2      7      0      0      5      17      8  47% [T19L,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D..I...G....D.FPFANSNK..R.V.....H..K....      17      1     12      4      0      0      0      0      17     16  94% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I-S..--.D......G....D..PFANSNK..R.V.....H..K....      17      0      7      9      0      0      1      0      17     12  70% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFANSNKN.R.V.....H..K....      17      0      2     15      0      0      0      0      17     14  82% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFA.........R....H.L.....      17      0      0     17      0      0      0      0      17     15  88% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFA........V.....H.......      17      0      0     17      0      0      0      0      17     14  82% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V...V.H..K....      16     10      2      3      0      0      1      0      16     12  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I670V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....H.FPFANSNK..Q..R....H.LK....      16      3      2     11      0      0      0      0      16     14  87% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339H,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..IS-..--ID......G....D.FPFANSNK..R.V.....H..K....      16      0      0     16      0      0      0      0      16     14  87% [T19I,L24S,P25-,P26H,A27-,Y28-,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
G.I-S..--.D......G....D.FPFANSNK..R.V.....H.LK....      16      0      0     16      0      0      0      0      16     15  93% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..RYV.....H..K....      16      3      7      4      1      0      0      1      16     14  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,N460Y,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.-T-.D......G....D.FPFANSNK..R.V.....H..K....      16      0      4      5      6      1      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,I68-,H69T,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I.......D......G....D.FPFANSNK..R.V.....H..K....      16      0      0      0     16      0      0      0      16     12  75% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G..I.D.FPFANSNK..Q..R....H.LK....      16      0      1     15      0      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,T259I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
G.I-S..--.D......G....D.FPFANSNK..R.V.I...H..K....      16      8      2      5      0      0      1      0      16     11  68% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547I,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D.E....G....DTFPFANSNK..R.V..S..H..K....      16      0      0     16      0      0      0      0      16     16 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK.SM..R....H..K....      16      0      1      0      0      0     15      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452M
..I-S..--.D......G....D.FPFANSN.....V........K....      16      0     16      0      0      0      0      0      16      9  56% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I-S.L...D......G....D.FPFANSNK..Q..R....H.LK....      16      0      0     16      0      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,I68L,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D..PFA.........R....H.......      16      0      0     16      0      0      0      0      16     13  81% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G....DTFPFANSNK..R.V.....H..KS...      16      5      0      0     11      0      0      0      16     15  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
...-S..--.D......G....D.FPFANSNK..R.V........K....      16      0      0      0     16      0      0      0      16     14  87% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
.FI-S..--.D......G....D..PFANSNK..R.V.....H..K....      16      0      3      0      0      0     13      0      16     11  68% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,N185Y,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S............G........................H.......      16      0      0     16      0      0      0      0      16      9  56% [T19I,L24-,P25-,P26-,A27S,V213G,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D...........D.FP.AN.NK..R.V.....H..K....      16      0      0      0      6     10      0      0      16     14  87% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G339D,S371F,S373P,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G.F..D.FPFANSNK..R.V.....H..KS...      16      0      2      2     12      0      0      0      16     16 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S..Y..D......G....D.FPFANSNK..M..R....H..K....      16      0      0      0     16      0      0      0      16     11  68% [T19I,L24-,P25-,P26-,A27S,H69Y,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,W886L,Q954H,N969K] Omicron_BA.2+L452M
..I.......D......G....D.FPFANSNK.....R....H..K....      15      0      2      3      9      0      0      1      15      7  46% [T19I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+P25_,P26_
..I-S.....D......G....DKFPFANSNK..Q..R....H.LK....      15      1      0     14      0      0      0      0      15      9  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......GN...D.FPFANSN......R....H..K....      15      0     13      1      0      0      1      0      15     11  73% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,+247SGE,Y248N,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK.....R....H..K..S.      15      1      1     12      1      0      0      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263S] Omicron_BA.2
...-S..--.D-.....G....D.FPFANSNK..R.V.....H..K....      15      0      7      0      8      0      0      0      15      7  46% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D..I...G....D.FPFANSNK..Q..R....H.LK....      15      0      2     13      0      0      0      0      15     15 100% [T19I,L24-,P25-,P26-,A27S,G142D,M153I,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......GS...D.FPFANSN......R....H..K....      15      0      8      1      3      0      3      0      15      7  46% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
G..-S..--.D......G....D.FPFANSNK..R.V.....H..K....      15      0      9      5      1      0      0      0      15     11  73% [V3G,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R..........K....      15      0     15      0      0      0      0      0      15      5  33% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D..PFANSNK..Q.......H.LK....      15      0      0     15      0      0      0      0      15      5  33% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D.....VG....D.FPFANSN...R.V.....H..K....      15      0      5      2      0      0      8      0      15     14  93% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--........G....D.FPFANSNK..R.V.....H..K....      15      0      2      2      0     10      1      0      15     13  86% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSN...R.V........K....      15      0     15      0      0      0      0      0      15     11  73% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G.F..D.FPFANSNK..R.V.....HS.K....      15      0      0     15      0      0      0      0      15     15 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701S,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..Y..D......G....D.FPFANSNK..Q..R....H.LK....      14      0      0     13      1      0      0      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69Y,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.T...D...L..G....D.FPFANSNK.....R....H..K....      14      0     13      0      1      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFAN.NK..R.V.....H..K.L..      14      0      5      4      4      0      1      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162L] 
..I.......D......GS...D.FPFANSTKN....R....H..K....      14      0      0      0     14      0      0      0      14     14 100% [T19I,G142D,V213G,S247N,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,K444N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
.FI-S.....D......G....D.FPFANSN......R....H..K....      14      0      8      2      0      0      4      0      14      9  64% [L5F,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
.FI-SR....D......G....D.FPFANSNK.....R....H..K....      14      0      4      3      7      0      0      0      14     13  92% [L5F,T19I,L24-,P25-,P26-,A27S,W64R,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--ID......G....D.FPFANSNK..R.V.....H.LK....      14      2      1     11      0      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..L-S.....D......G....D.FPFANSNK..Q..R....H.LK....      14      0      1     13      0      0      0      0      14     14 100% [T19L,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.LPF...NK.....R....H..K....      14      0      0      0      0      0     14      0      14      8  57% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371L,S373P,S375F,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.T...D......G....D.FPFAN.NK.....R....H..K....      14      0      0      0      3      0     11      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI-S..--.D......G....D.FPFANSNK..R.V.....H..K.S..      14      0      1      1      0      0     12      0      14     10  71% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,N185Y,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSTK.....R....H..K...L      14      0      2     12      0      0      0      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] Omicron_BA.2+K417T
..I-S..--.D......G....D.FPFAN.......V..S..H..K....      14      0      0     14      0      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S.....D......G....D.FPFANSNK..R.V.....H..K....      14      0      6      4      3      0      1      0      14     13  92% [V3G,T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
...-S..--.D......G....D.FPFANSNK..R.V.....H..KS...      14      0      6      0      8      0      0      0      14     12  85% [L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I-S.....D......G....D..PFA.........R....H.LK....      14      0      0     14      0      0      0      0      14     10  71% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.NK..Q.......H.LK....      14      0      1     13      0      0      0      0      14     13  92% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452Q,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....DTFPFAN.NK..R.V.....H..K....      14      0      6      0      3      0      5      0      14     12  85% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK.....R...EH.LK....      14      0      0      0     14      0      0      0      14     14 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,Q677E,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D.N....G....D.FPFANSNK.....R....H..K....      13      3      4      1      1      0      2      2      13     10  76% [T19I,L24-,P25-,P26-,A27S,G142D,K147N,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S..--.D......G....D.FPFANSNK..R.V.....HV.KS...      13      1     10      0      2      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
.FI-S..--........G....D.FPFANSN...R.V.....H..K....      13      0     11      2      0      0      0      0      13     10  76% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D....K.G....D.FPFANSNK..Q..R....H.LK.L..      13      0      0     13      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,P1162L] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S..--.D......G.P..D.FPFANSNK..R.V.....H..K....      13      2      4      6      1      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255P,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID...L..G....D.FPFANSNK..R.V.....H..K....      13      0      0     13      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSTK.....R....H..K...L      13      0      1      2      8      0      0      2      13     11  84% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,S71F,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478R,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
..I-S..--.D-.....G....DTFPFANSNK..R.V..S..H..K....      13      7      0      6      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......GN...DTFPFANSNKR....R....H..K....      13      0      3      0     10      0      0      0      13     10  76% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.F--.D......G....D.FPFANSNK..R.V.....H..K....      13      3      1      9      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,I68F,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D-.....G....D.FPFANSNK..R.V..S..H..K....      13      2      4      6      0      0      1      0      13     10  76% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S............G....D.FPFANST......R....H..K....      13      0      8      3      2      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANS......V.....H..K....      13      0      0     13      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-SR.--.D......G....D.FPFANSNK..R.V.....H..K....      13      2      8      3      0      0      0      0      13     13 100% [T19I,L24-,P25-,P26-,A27S,W64R,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--........G....D.FPFANSN...R.V.....H..KS...      13      0      5      4      4      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
..I-S..--.D......G..................V..S..H.......      13      0      0     13      0      0      0      0      13     12  92% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D......G......FPFANSNK.....R....H..K....      12      0      7      0      1      0      3      1      12      5  41% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.T...D......G.F..D.FPFANSNK.....R....H..K....      12      1     11      0      0      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,I68T,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK..M..R.......K....      12      0     12      0      0      0      0      0      12      4  33% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN..K.....R....H..K....      12      0      2      8      0      0      2      0      12      9  75% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D...L..G....D.FPFANSNK..R.V.....H..K....      12      3      2      4      2      1      0      0      12      9  75% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,F157L,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK..Q..R....H..K....      12      0      2     10      0      0      0      0      12      9  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNK..R.V.....HT.K....      12      3      5      4      0      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701T,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......GH...D.FPFANSTK.....R....H..K....      12      1      0     11      0      0      0      0      12      7  58% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248H,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2+K417T
G.I-S..--.D......G....D.FPFANSNK..R.V.....H..K.S..      12      0      3      8      0      0      0      1      12     12 100% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1162S] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK..R.V.....H.LK....      12      0      0     10      1      0      1      0      12      8  66% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D....K.G....D.FPFA.........R....H.LK....      12      0      0     12      0      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,S371F,S373P,S375F,T376A,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G..................V.....H..K....      12      0      0     12      0      0      0      0      12      7  58% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....DKFPFANSNK..R.V.....H..K....      12      5      7      0      0      0      0      0      12     12 100% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,R346K,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--........G....D.FPFANSNK..R.V..S..H..K....      12      0      5      3      0      0      4      0      12      9  75% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D-.....G...ID.FPFANSNK..R.V.....H..K....      12      1      9      2      0      0      0      0      12     11  91% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,Y144-,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANSNK.....R....H..KS...      12      0      0     12      0      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.2
..I-S..--.D......G....D.FPFA.SN...R.V.....H..K....      12      0      1     11      0      0      0      0      12      8  66% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D-.....G....D.FPFANSTK.SQ..R....H..K...L      12      0      0      4      8      0      0      0      12     10  83% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,S71F,G142D,Y144-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417T,N440K,G446S,L452Q,S477N,T478R,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,V1264L] 
..I-SL.--.D......G....D.FPFANSNK..R.V.....H..K....      11      0      7      3      0      0      1      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,W64L,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D...S..G....D.FPFAN.NK.....R....H..K....      11      0     10      0      1      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,G142D,F157S,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFAN..K..R.V.....H..K....      11      0      0     11      0      0      0      0      11     10  90% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFAN.NK.....R....H..K....      11      0      1      3      5      0      2      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D....K.G....DIFPFANSNK..Q..R....H.LK....      11      0      1     10      0      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,G142D,N164K,V213G,G339D,R346I,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFANSNK..R.......H..K....      11      0      3      6      2      0      0      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--ID......G....D.FPFANSNK..R.V...V.H..K....      11      7      0      4      0      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I670V,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFAN.NK..R.V.....H..K..Q.      11      0      7      1      1      0      2      0      11      8  72% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263Q] 
..I-S.....D......G....D.FPFANSNK.....R....H..KV...      11      0      2      5      2      0      0      2      11      4  36% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020V] Omicron_BA.2
..I-S.....D......G....D.FPFANSNKR....R....H..K....      11      0      4      3      2      0      0      2      11      6  54% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G....D.FPFANSNK..Q..R...HH.LK....      11      0      0     11      0      0      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,Q677H,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFAN.NK..Q..R....H.LK...L      11      0      0      0      0      0     11      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K,V1264L] 
..I-S..--.D......G....D.FPFANSNK..R.V.....R..K....      11      0      2      9      0      0      0      0      11     11 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681R,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNK.SR.V.....H..K....      11      0      4      7      0      0      0      0      11      7  63% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,G446S,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--........G....D.FPFANS.K..R.V.....H..K....      11      0      6      3      1      1      0      0      11     10  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.-I-S..--.D......G....D.FPFANSNK..R.V.....H..K....      11      0      6      5      0      0      0      0      11      4  36% [L5-,+5X,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G...................R....H.LK....      11      0      0     11      0      0      0      0      11      7  63% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSN...R.V...V.H..K....      11      0      7      2      2      0      0      0      11     10  90% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,I670V,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNK..R.V.....H.......      11      0      5      1      5      0      0      0      11      7  63% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--........G........................H.......      11      0      0     11      0      0      0      0      11      7  63% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,V213G,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S..--.D......G..A.D.FPFANSN...R.V.....H..K....      11      0      7      4      0      0      0      0      11      9  81% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,T259A,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....DTFPFAN.NK.....R....H..K....      11      0      1      0      0      0     10      0      11      7  63% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI-S..--.D.....EG....D.FPFANSNK..R.V.....H..K....      10      0      7      3      0      0      0      0      10      6  60% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181E,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,Q1113K] Omicron_BA.4andBA.5
..I-S.....D.E....G....DTFPFANSNK.....R....H..K....      10      0      8      0      2      0      0      0      10      5  50% [T19I,L24-,P25-,P26-,A27S,G142D,K147E,V213G,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D......G...................R....H..K....      10      0      0     10      0      0      0      0      10      4  40% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSNK..M..R....H..K..L.      10      3      4      1      0      0      2      0      10      6  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,T678I,N679K,P681H,N764K,D796Y,Q954H,N969K,P1263L] Omicron_BA.2+L452M
..I-S.....D......G....D..PFANSNK..M..R....H..K....      10      1      3      1      0      0      5      0      10      6  60% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452M,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-SC.--.D......G...ID.FPFANSNK..R.V.....H..K....      10      1      9      0      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,W64C,H69-,V70-,G142D,V213G,V289I,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--ID......G....D.FPFANSNK..R.V.K...H..K....      10      0      0     10      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G....D.FPFANSNK.....R....Y..K....      10      0      2      0      6      0      0      2      10      5  50% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681Y,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFAN.NK..R.......H..K....      10      0      8      0      1      0      1      0      10      3  30% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNK..R.V.....HV.K....      10      2      0      5      0      0      3      0      10      9  90% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,A701V,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
GFI-S..--.D......G....D.FPFANSNK..R.V.....H..K....      10      0      4      3      2      0      1      0      10      9  90% [V3G,L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..-L.D......G....D.FPFANSNK..R.V..S..H..K....      10      0     10      0      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N658S,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......GS...D.FPFANSNK..Q..R....H.LK....      10      0      0     10      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248S,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......GNF..DTFPFANSNK.....R....H..K....      10      0      0      0     10      0      0      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,Y248N,S255F,G339D,R346T,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.2
..I-S.....D..T...G....D.FPFANSNK..Q..R....H.LK....      10      0      0     10      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,G142D,M153T,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] Omicron_BA.2+L452Q+S704L_BA.2.12.1
..I-S.....D......G....D.FPFAN........R....H.L.....      10      0      0     10      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFAN.NK.....R....H.LK....      10      0      1      3      1      0      5      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G....D.FPFANSNKN.R.V.....H..KS...      10      0      1      7      2      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFAN.NK..R.V.....H.......      10      0      2      4      3      0      1      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 
..I-S.....D......G....D.FPFANSN...R..R....H..K....      10      0      8      0      0      0      2      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D.....VG....D.FPFANSNK..R.V.....H..K....      10      0      1      6      2      1      0      0      10      8  80% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,G181V,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..........K.G....D.FPFANSN...Q..R....H.LK....      10      0      4      5      0      0      1      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,N164K,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
..I-S.....D......G....N.FPFANSNK..Q..R....H.LK....      10      0      0     10      0      0      0      0      10      9  90% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,G339N,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452Q,S477N,T478K,E484A,Q493R,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,S704L,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G....D.FPFANSNKN.R.V.....H..K....      10      0      0     10      0      0      0      0      10     10 100% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G.F..D.FPFANSN...R.V.....H..K....      10      0      1      1      0      0      8      0      10      8  80% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
G.I-S..--.D......G.F..D.FPFANSNK..R.V.....H..K....      10      0      1      5      4      0      0      0      10      7  70% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S..--.D......G....D.FPFANS.K..R.V.....H..KS...      10      0      1      1      8      0      0      0      10      4  40% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,A1020S] 
G.I-S..--.D......G....D.FPFANSNKT.R.V.....H..K....      10      1      4      0      0      5      0      0      10     10 100% [V3G,T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,K444T,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K,I1221T] Omicron_BA.4andBA.5
..I-S..--ID......G....D.FPFAN.N...R.V.....H..K....      10      0      0     10      0      0      0      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,T76I,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,K417N,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
..I-S..--.D......G.F..D.FPFAN.NK..R.V.....H..K....      10      0      8      0      1      0      1      0      10     10 100% [T19I,L24-,P25-,P26-,A27S,H69-,V70-,G142D,V213G,S255F,G339D,S371F,S373P,S375F,T376A,D405N,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] 
.FI-S..-L.D......G....D.FPFANSNK..R.V.....H..K....      10      0     10      0      0      0      0      0      10     10 100% [L5F,T19I,L24-,P25-,P26-,A27S,H69-,V70L,S71X,G142D,V213G,G339D,S371F,S373P,S375F,T376A,D405N,R408S,K417N,N440K,L452R,S477N,T478K,E484A,F486V,Q498R,N501Y,Y505H,D614G,H655Y,N679K,P681H,N764K,D796Y,Q954H,N969K] Omicron_BA.4andBA.5
..I-S.....D......G........................H.......      10      0      0     10      0      0      0      0      10      4  40% [T19I,L24-,P25-,P26-,A27S,G142D,V213G,D614G,H655Y,N679K,P681H,D796Y,Q954H,N969K] 

Download

 

last modified: Mon Aug 1 18:21 2022



GISAID data provided on this website is subject to GISAID's Terms and Conditions
Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health