COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


Embers

Embers: follow emergent SARS-CoV-2 variants over time

Last update: Jul 31, 2021
Run Geographically Restricted Embers
Download

Global
Variants color key

Variants and Counts
                                                                               111111
               1111111111112222222222222223334444444444556666666777777788888999001112
 111122566777892344455555891244444444555550461135577899071155778013678935589558271171
5238906279056056823424678905223456789012386674790278404103435571162920694989072711869
LSSLTTPQAHVGTDTVDGVYWEEFRLRDALALHRSYLTPGDWFRVQKNNLSTEFSNAQDAHQQPATTGVEDDKTFADQSTQEDVG Counts Percent Lineage
_____________________________________________________________________________________    386   0.03% Ancestral            
._________________________________________________________G__________________________  48457   4.02% G-clade              
.__.________________________V_____________________________G__________________________  24124   2.00% GV-clade             
._________________________________________________________G____*_____________________   4265   0.35% Near-Furin           
__________________________________________________________G___*______________________   6346   0.53% Near-Furin           
__________________________________________________________G__*_______________________   4675   0.39% Near-Furin           
....._...--........-_...............................__.YD.G....H.I............A...H.. 723786  60.06% B.1.1.7=Alpha        
....._...--........-R..................................YD.G....H.I............A...H..  12394   1.03% Alpha+W152R          
....._...--........-................................K..YD.G....H.I............A...H..   2056   0.17% Alpha+E484K          
....._...--........-_..............................._S.YD.G....H.I............A...H..   2842   0.24% Alpha+F490S          
.....I...--........-_..............................._..YD.G....H.I............A...H..   2350   0.19% Alpha+T20I           
.............A.............G.---..............N.....K..Y..G.....V....................   7271   0.60% B.1.351=Beta         
.....NS.........Y.........S.........................K..Y..G.Y..................I...F.  42185   3.50% P.1=Gamma            
....R....._...........--G..._............_...._..R.K......G....R............N........ 124524  10.33% B.1.617.2=Delta      
....R....._...........--G...V............_...._..R.K......G....R............N........  14778   1.23% B.1.617.2=Delta+A222V
....R.....F...........--G...V............_....N..R.K......G....R............N........    393   0.03% B.1.617.2=AY.2       
....R....._...I.......--G................L....N..R.K......G....R............N........    198   0.02% B.1.617.2=AY.1       
..I.................C............................R........G..........................  20591   1.71% B.1.429/7=Epsilon    
.............._..............................._.....K.._..G..............._........F.   2171   0.18% P.2=Zeta             
.......RV--........-................................K.....G...H...........L..........   4293   0.36% B.1.525=Eta          
..............I.........................G.................G.....V............_.......  20186   1.67% B.1.526=Iota         
..............I.........................G.........N.......G....._............R.......   9355   0.78% B.1.526.2            
.............G.....-...S.........................R........G..............N..H........   8012   0.66% B.1.526.1            
......................___........................R..Q.....G....R.....................   2797   0.23% B.1.617.1=Kappa      
...........VI.....................------.........Q...S....G..............N...........   2331   0.19% C.37=Lambda          
.................................................R.....Y.._VY.........Y.............V    317   0.03% A.27                 
.......................L....................F............H_....R.....................    400   0.03% A.23.1               
...................................................K......G....H..A..................  16546   1.37% B.1.1.519            
....................L...............................K.....G........V.................   7990   0.66% R.1                  
......................................................P_..G....H.I............_..._..   2459   0.20% B.1.575              
.........--..............F.....................K..........G.........I................   4035   0.33% B.1.258.17           
.._..............--........._....................R.._.....G.............._.._........    619   0.05% A.2.5.2              
.............................................K..K.........G......I...................   1089   0.09% B.1.214.2            
.F.......--.........R......................S.....R........G...H............S.........   1056   0.09% C.36                 
......................---.................L.........K.P...G..........A.V.......I.....    251   0.02% B.1.1.523            
......S..--....A...-.........---Y.................N.K.....G....H...............I..H..    536   0.04% B.1.620              
......................................................PY..G....H........N........K...    599   0.05% B.1.623              
..............I....-................................K.....G....H......H..............   2821   0.23% B.1.1.318            


The most common sequence patterns that are missed by the varint patterns
                                                                               111111
               1111111111112222222222222223334444444444556666666777777788888999001112
 111122566777892344455555891244444444555550461135577899071155778013678935589558271171
5238906279056056823424678905223456789012386674790278404103435571162920694989072711869
LSSLTTPQAHVGTDTVDGVYWEEFRLRDALALHRSYLTPGDWFRVQKNNLSTEFSNAQDAHQQPATTGVEDDKTFADQSTQEDVG Counts Percent NearbyLineage(s)
__________________________________________________N_______G__________________________   6380   0.53% G-clade
____________________________________________________K_____G____________________I_____   1966   0.16% P.2=Zeta
_______________________________________________________Y__G__________________________   1853   0.15% G-clade
_________--____________________________________K__________G__________________________   1844   0.15% 
_______________________________________________K__________G__________________________   1554   0.13% G-clade
_________--________-___________________________________YD_G____R_I____________A___H__   1471   0.12% B.1.1.7=Alpha
_________--____________________________________________YD_G____H_I____________A___H__   1389   0.12% B.1.1.7=Alpha
_________-F________-___________________________________YD_G____H_I____________A___H__   1157   0.10% B.1.1.7=Alpha
__________________________________________________________GV_H_______________________   1126   0.09% 
_______________________________________________K__________G____R_____________________   1088   0.09% 
___F______________________________________________________G__________Q_______________   1028   0.09% 
________________Y_________________________________________G__________________________    977   0.08% G-clade
__________________________________________________________G_______A__________________    887   0.07% G-clade
___F_NS___________________S___________________T_____K__Y__G_Y__________________I___F_    871   0.07% P.1=Gamma
______________I____S_______________________K________K__Y__G____H____________N________    818   0.07% 
___F______________________________________________________G__________________________    816   0.07% G-clade, GV-clade
________________Y_________________________________N_______G__R_______________________    777   0.06% 
_____I____________________________________________________G__________________________    775   0.06% G-clade
_________--________-___________________________________YD_G____H______________A___H__    753   0.06% B.1.1.7=Alpha
_______________________________________________________T__G__________________________    750   0.06% G-clade
_________________________________________________R________G__________________________    704   0.06% G-clade
__________________________________________________N_______G__H_______________________    661   0.05% 
____________________________V_____________________________G__H_______________________    613   0.05% GV-clade
F________--________-___________________________________YD_G____H_I____________A___Y__    598   0.05% B.1.1.7=Alpha
_________--_______-F___________________________________YD_G____H_I____________A___H__    546   0.05% B.1.1.7=Alpha
_______________________________________________________YD_G____H_I____________A___H__    516   0.04% 
____________________________V_____________________________G_____________________L____    477   0.04% GV-clade
______________________________________________________P___G__________________________    464   0.04% G-clade
_________--________-____________________________________D_G____H_I____________A___H__    427   0.04% B.1.1.7=Alpha
_________________S________________________________________G___H______________________    403   0.03% 
F_________________________________________________________G___H______________________    402   0.03% G-clade
__________________________________________________________G________________________F_    389   0.03% G-clade, P.2=Zeta
____R_____F___I__D____--G________________________R_K______G____R____________N________    389   0.03% B.1.617.2=Delta
_________--________-_________________________________L_YD_G____H_I____________A___H__    388   0.03% B.1.1.7=Alpha, Alpha+W152R, Alpha+E484K, Alpha+F490S, Alpha+T20I
_F________________________________________________________G__________________________    360   0.03% G-clade
___R__________I_________S_________________________________G____H_______________I_____    335   0.03% 
______________________________________________________PY__G____H_________________K___    333   0.03% B.1.623
_________--________-___________________________________YD_G____H_I________________H__    329   0.03% B.1.1.7=Alpha
_________--_______________________________________________G__________________________    324   0.03% 
____R_________I_______--G________________________R_K______G____R_____________________    320   0.03% B.1.617.2=Delta
____________________________________________________K_____G__________________________    316   0.03% G-clade, P.2=Zeta
____R____________________________________________R_K______G____R____________N________    314   0.03% B.1.617.1=Kappa
_F_______________________________________________R________G___H______________________    310   0.03% 
__________________________________________________________G________V_________________    309   0.03% G-clade
__________________________________________________________G_____V____________________    289   0.02% G-clade
______________I___________________________________________G__________________________    271   0.02% G-clade
_________--________-___________________________________Y__G____H_I____________A___H__    267   0.02% B.1.1.7=Alpha
__________________________________________________________G___H___S__________________    261   0.02% 
_________________________________________________Q________G__________________________    260   0.02% G-clade
____R_________________--G________________________R_K______G____R_____________________    255   0.02% B.1.617.2=Delta

Download

 

last modified: Tue Jun 22 15:04 2021



GISAID data provided on this website is subject to GISAID's Terms and Conditions

Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health