COVID-19 Viral Genome Analysis Pipeline COVID-19 Viral Genome Analysis Pipeline home COVID-19 Viral Genome Analysis Pipeline home
COVID-19 Viral Genome Analysis Pipeline
Enabled by data from   gisaid-logo


Embers

Embers: follow emergent SARS-CoV-2 variants over time

Run Geographically Restricted Embers
Last update: Dec 3, 2021


Delta Variants
Global
Early 2021 Variants color key
Delta Variants color key
Download


Variants and Counts
                                                         11111
           111111111122222222222222223444445566666667789900112
11222677789134445555912444444455555894157890711577780155827176
89069905605282452678052234678901238996728401034557911690274864
LTTPTHVGTDTSDGYYWEFRRDALALRSYLTPGDWVTRKLTEFNAQDHQQNPATTDSTNDVV Counts Percent Lineage
.R...._..........G--.._..........._..._RKQ....G____R...N....._   2688   0.14% Delta+E484Q                      
.R...._..........--G.._..........._..._RKQ....G____R...N....._      0   0.00% Delta+E484Q                      
.R...._..........--G.............._..._RK.....G...*....N......      0   0.00% Delta+FurinRelated               
.R...._..........--G.............._..._RK.....G..*.....N......      0   0.00% Delta+FurinRelated               
.R...._..........--G.............._..._RK.....G.*......N......      0   0.00% Delta+FurinRelated               
.R...._..........--G.............._..._RK.....G....H...N......      0   0.00% Delta+FurinRelated               
.R...._..........--G.............._..._RK.....GY.......N......      0   0.00% Delta+FurinRelated               
.R...._..........G--.............._..._RK.....G...*....N......    709   0.04% Delta+FurinRelated               
.R...._..........G--.............._..._RK.....G..*.....N......  10048   0.54% Delta+FurinRelated               
.R...._..........G--.............._..._RK.....G.*......N......   5985   0.32% Delta+FurinRelated               
.R...._..........G--.............._..._RK.....G....H...N......    407   0.02% Delta+FurinRelated               
.R...._..........G--.............._..._RK.....GY.......N......   1680   0.09% Delta+FurinRelated               
.R...._..._......G--..V..........._I.._RK.....G____R...N....._  20928   1.12% Delta+T95_,A222V,V289I           
.R...._..._......--G..V..........._I.._RK.....G____R...N....._      0   0.00% Delta+T95_,A222V,V289I           
.R...._..._......G--.._........L.._..._RK_....G____R...N....._  13057   0.70% Delta+T95_,P251L                 
.R...._..._......--G.._........L.._..._RK_....G____R...N....._      0   0.00% Delta+T95_,P251L                 
.R...._...I....H.G--.............._..._RK.....G____R...N.....L   8372   0.45% Delta+Y145H,V1264L               
.R...._...I....H.--G.............._..._RK.....G____R...N.....L      0   0.00% Delta+Y145H,V1264L               
.R...._...I....H.G--..V..........._..._RK.....G____R...N....._  41373   2.20% Delta+Y145H,A222V                
.R...._...I....H.--G..V..........._..._RK.....G____R...N....._      0   0.00% Delta+Y145H,A222V                
.R....F..........G--..V..........._...NRK.....G........N......   1343   0.07% Delta+T95_,V70F,A222V,K417N      
.R....F..........--G..V..........._...NRK.....G........N......      0   0.00% Delta+T95_,V70F,A222V,K417N      
.R..A._..._......--G.._.......I..._.I._RK_...HG____R...N....._      0   0.00% Delta+T29A,T95_,T250I,T299I,Q613H
.R..A._..._......G--.._.......I..._.I._RK_...HG____R...N....._   2997   0.16% Delta+T29A,T95_,T250I,T299I,Q613H
.R..A._..._......G--.._.......I..._._._RK_..._G____R...N....._   3666   0.20% Delta+T29A,T95_,T250I            
.R..A._..._......--G.._.......I..._._._RK_..._G____R...N....._      0   0.00% Delta+T29A,T95_,T250I            
.R...._..........G--.............._..._RK.....G____R...N..S..L   7969   0.42% Delta+N1074S,V1264L              
.R...._..........--G.............._..._RK.....G____R...N..S..L      0   0.00% Delta+N1074S,V1264L              
.R...._........_.G--.............._..._RK.....G____R...N.._..L  27478   1.46% Delta+V1264L                     
.R...._........_.--G.............._..._RK.....G____R...N.._..L      0   0.00% Delta+V1264L                     
.R.........L.....G--.._..........._..._RK_....G____R...N....._  38595   2.06% Delta+S112L                      
.R.........L.....--G.._..........._..._RK_....G____R...N....._      1   0.00% Delta+S112L                      
.R...._..._......G--..V...........__.._RK.....G____R...N....._  85041   4.53% Delta+T95_,A222V                 
.R...._..._......--G..V...........__.._RK.....G____R...N....._      1   0.00% Delta+T95_,A222V                 
.R.._._...._.....G--.._.......__.._._._RK_..._G____R...N....._ 1398815  74.53% Delta                            
.R.._._...._.....--G.._.......__.._._._RK_..._G____R...N....._     24   0.00% Delta                            
....................S....................K.Y..GY...*........F.   3832   0.20% Gamma+FurinRelated               
....................S....................K.Y..GY..*.........F.   1499   0.08% Gamma+FurinRelated               
....................S....................K.Y..GY.*..........F.    296   0.02% Gamma+FurinRelated               
....................S....................K.Y..GY*...........F.    800   0.04% Gamma+FurinRelated               
....................S....................K.Y..GY____........F.  27541   1.47% Gamma                            
..........I...SN.....................K...K.Y..G....H...N......   4698   0.25% Mu                               
.......VI..................-------.....Q..S...G.......N.......   3480   0.19% Lambda                           
.........A...........G.---............N..K.Y..G.....V.........    783   0.04% Beta                             
.._..--.......-._........................_SYD.G....H.I..A..H..    507   0.03% Alpha+F490S                      
.._..--.......-..........................K.YD.G....H.I..A..H..    734   0.04% Alpha+E484K                      
.._..--.......-._........................__YD.G....H._..A..H..    136   0.01% Alpha                            
.._..--.......-._........................__YD.G....R.I..A..H..     72   0.00% Alpha                            
.._..--......._._........................__YD.G....H.I..A..H..    277   0.01% Alpha                            
.._..--.......-._........................__YD.G....H.I..A..H..  62942   3.35% Alpha                            


The most common sequence patterns that are missed by the varint patterns
Missing: 4134 patterns, for a total of 98099 sequences
                                                         11111
           111111111122222222222222223444445566666667789900112
11222677789134445555912444444455555894157890711577780155827176
89069905605282452678052234678901238996728401034557911690274864
LTTPTHVGTDTSDGYYWEFRRDALALRSYLTPGDWVTRKLTEFNAQDHQQNPATTDSTNDVV Counts Percent NearbyLineage(s)
_R_______________G--___________________RK_____G____R__________  10809   0.58% 
_R________I______G--___________________RK_____G____R__________   5258   0.28% 
_R____I______D___G--___________________RK_____G____R___N______   4866   0.26% 
_R___________D___G--___________________RK____HG____R___N______   3947   0.21% 
______________________________________________G_______________   3493   0.19% 
_R____I__________G--___________________RK_____G____R___N______   2792   0.15% 
_R_____________________________________RK_____G____R___N______   2520   0.13% 
_R____F___I__D___G--___________________RK_____G____R___N______   2177   0.12% 
_R_______________G--__V________________RK_____G____R__________   2008   0.11% 
_____--_______-_R__________________________YD_G____H_I__A__H__   1930   0.10% 
_R___________D___G--______________R____RK_____G____R___N______   1886   0.10% 
_______________________________________RK_____G____R___N______   1340   0.07% 
_R___________D___G--___________________RK_____G____R__________   1335   0.07% 
_________________________________________K____G__________I____   1215   0.06% 
R_________I________S__________________________G____H_____I____   1153   0.06% 
_R________I__D___G--___________________RK____HG____R___N______   1134   0.06% 
_R__I_____I__D___G--___________________RK_____G____R___N______   1042   0.06% 
_R___________D___G--______________L____RK_____G____R___N______   1019   0.05% 
_R__A________D___G--__________I________RK____HG____R___N______    955   0.05% 
_R_______________G--___________________RK____HG____R___N______    882   0.05% 
___________________________________________Y__G_______________    801   0.04% 
_R________I__D___G--______________L___NRK_____G____R___N______    751   0.04% 
_R________I____________________________RK_____G____R___N______    734   0.04% 
_R________I__D___G--__V________________RK_____G____R___N______    723   0.04% 
_R________I__D___G--______________L____RK_____G____R___N______    647   0.03% 
__________I______________________G_______K____G_____V_________    640   0.03% 
__________I___-__________________________K____G____H__________    612   0.03% 
_R___________D___G--__S________________RK_____G____R___N______    585   0.03% 
_________G____-___S____________________R______G_______NH______    577   0.03% 
_R_______________G--____________________K_____G____R___N______    565   0.03% 
_R________I______G--__V________________RK_____G____R___N______    528   0.03% 
_R____F______D___G--___________________RK_____G____R___N______    521   0.03% 
_____________D___G--___________________RK_____G____R___N______    515   0.03% 
_R_______________________________________K____G________N______    505   0.03% 
_R________I__D___G--___________________RK_____G____R__________    483   0.03% 
_R_________L_____G--___________________RK_____G____R__________    482   0.03% 
_R________I__D___G--__S________________RK_____G____R___N______    475   0.03% 
_R________I__D___G--__________I________RK_____G____R___N______    461   0.02% 
_R__I________D___G--___________________RK_____G____R___N______    446   0.02% 
_R___________D_________________________RK_____G____R___N______    442   0.02% 
_R___________D___G--____________________K_____G____R___N______    431   0.02% 
________________________________________K_____G____H__________    419   0.02% 
_R_______________G--___________________RK___S_G____R__________    405   0.02% 
_R___--__________G--___________________RK_____G____R___N______    368   0.02% 
_R___________D___G--________________I__RK_____G____R___N______    368   0.02% 
_R_______________G--__V____________I___RK_____G____R__________    360   0.02% 
______________________________________________G____R__________    360   0.02% 
_R________I__D___G--__________N________RK_____G____R___N______    355   0.02% 
_R________I__D_________________________RK_____G____R___N______    340   0.02% 
_____--_________R____________________S_R______G__H____________    327   0.02% 

Download

 

last modified: Sat Nov 13 13:34 2021



GISAID data provided on this website is subject to GISAID's Terms and Conditions
Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health